Details for Papaya Locus evm.TU.supercontig_19.37

Position : sup19 ( 5`- 316659 .. 319694 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.37

Protein [Map View]
MSKPSARLIQGLLRLRFNGGNLSTMSKPSSDAMSACLDPVRFSSSSSRFPSNGSSMFPSKLHFHSLSSNPTSSKLRLSQV
LYCSQHNPRQCFNPLGLALAKPQPNLSSGIRFFSLKSSGLGKKVDGNFAKNVFDKPVAAVTSAFSRYREAIGLQIDAFCK
NNYLVLLGGGAVLVCALLWKIMFGIANAFVGISEGMAKYGFLALSTAIVAFFGLYLRSRFTINPDKVYRMAMRRLNTSAG
VLEVMGAPLTGTDLRAYVMSGGGITLKTFKPSFRSKRCFLIFPIRGSERKGLVSVGVKNKKGQYDIKLLAVDIPMASGPD
QRLFLVGDEEEYGVGGGLISQLRDPVVKVMAATKEFDDLDRIEEEEDAEKELKEAERKHQGEIEKLEKDGMR

DNA
ATGTCAAAACCCTCTGCAAGACTCATTCAGGGTCTTCTCAGGTTGCGCTTCAATGGAGGCAACTTATCAACCATGTCAAA
ACCCTCCTCGGACGCCATGTCTGCATGTCTTGATCCCGTTCGGTTTTCTTCTTCTTCTTCTCGTTTCCCCTCAAATGGAT
CCTCTATGTTTCCATCTAAGCTCCATTTCCACTCTCTCTCTTCAAATCCCACTTCTTCAAAACTCCGTTTATCCCAGGTT
CTTTATTGCTCACAACACAATCCTCGACAATGCTTCAATCCCTTGGGCTTGGCGTTGGCCAAACCTCAACCGAATTTGTC
ATCGGGGATTAGATTCTTCTCCTTGAAGAGCTCAGGTTTAGGGAAAAAAGTTGATGGCAATTTCGCAAAGAATGTTTTTG
ATAAGCCAGTGGCAGCCGTTACCTCCGCTTTCTCGCGTTATCGTGAGGCTATTGGGTTGCAGATTGATGCATTTTGTAAA
AATAATTACTTGGTCCTGCTGGGAGGGGGAGCGGTTTTGGTCTGTGCTCTGCTTTGGAAGATTATGTTTGGGATTGCAAA
TGCTTTTGTCGGCATTTCCGAGGGTATGGCCAAGTATGGATTTCTCGCGCTTTCCACTGCCATTGTTGCCTTCTTCGGAT
TATACCTCCGCTCAAGGTTCACAATCAATCCTGATAAAGTTTATAGAATGGCCATGAGGAGGCTAAACACATCTGCTGGC
GTTCTTGAAGTAATGGGTGCCCCTCTGACAGGAACAGACTTGAGAGCCTATGTAATGTCAGGAGGTGGGATAACACTGAA
GACATTCAAGCCAAGTTTTAGGAGCAAGCGTTGTTTTCTGATTTTTCCCATACGAGGTTCTGAGAGAAAGGGCCTAGTCA
GTGTGGGAGTCAAGAATAAAAAAGGCCAGTATGACATAAAACTACTGGCAGTCGACATCCCTATGGCATCTGGTCCTGAC
CAGCGATTGTTCTTAGTTGGGGATGAAGAAGAGTACGGTGTTGGTGGTGGACTAATATCTCAGCTAAGAGATCCTGTGGT
GAAGGTAATGGCAGCAACGAAGGAATTTGATGATCTTGATCGAATTGAGGAAGAAGAGGATGCAGAAAAAGAGCTTAAGG
AGGCAGAAAGAAAGCACCAAGGAGAAATTGAAAAGCTTGAAAAAGATGGAATGCGGTGA