Details for Papaya Locus evm.TU.supercontig_19.35

Position : sup19 ( 5`- 303274 .. 300894 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_19.35

Protein [Map View]
MSSTSSISSGILPSKMLGTFESPITGASGSLSQPEPEFNDSGETQLLSLFWNQDYGCFAAGTSCGFRIYDCEPFKENFRR
DLKTGGFKIVEMLFRCNILALVGGGANSEYPANKVMIWDDYESRCMSEFSFRSEVRAVRLRRDRIVVVLEHKIYVYNFKD
LKLLHQIETLSNPRGLCCLSHHSNTSVLACPGLRRGQVRVEHFGLKMMKLINAHDSHVACMTLTLDGLLLATASAKGTLI
RIFNTMDGTRLQELRRGVDRANIFSITLSPNAQWLAVSSDKGTVHIFSLRVRVFGDDSSSNSSSGQGSALFNQNSSNSLD
ALISRNTGANPGSSLSFMRGVLPKYFSSEWSFAQFHLPEDTQFIAAFGSQNTVVIVGMDGSFYRCSFDPVHGGEMLQQEY
VSFLKTDRRSG

DNA
ATGAGTTCAACTAGTTCAATATCTAGCGGAATTCTTCCATCCAAAATGCTTGGCACCTTCGAATCCCCAATTACTGGAGC
TTCCGGTTCTCTAAGCCAGCCTGAACCAGAGTTCAATGACAGTGGTGAGACACAGCTGCTCTCTTTGTTCTGGAACCAGG
ATTATGGCTGCTTTGCTGCTGGCACAAGTTGTGGTTTTCGTATATATGACTGTGAACCATTCAAAGAAAATTTCAGACGT
GATCTGAAGACTGGCGGATTTAAAATTGTTGAGATGCTGTTCCGTTGCAACATCTTGGCACTTGTTGGTGGTGGAGCTAA
TTCAGAGTATCCTGCAAACAAAGTTATGATCTGGGATGATTATGAAAGTCGCTGCATGAGTGAATTTTCATTTAGGTCTG
AGGTTCGTGCTGTGAGATTAAGACGTGATCGCATTGTAGTGGTTCTTGAGCACAAGATATACGTCTACAATTTCAAGGAC
CTGAAACTCCTTCATCAGATTGAGACCCTGTCAAATCCTAGGGGACTGTGTTGCCTTTCTCACCATTCAAATACATCTGT
GTTGGCTTGTCCAGGTCTTCGTCGAGGACAGGTTCGAGTTGAACACTTTGGGCTGAAGATGATGAAATTAATTAATGCCC
ATGATTCTCATGTTGCTTGTATGACCTTGACTTTGGATGGCTTACTGCTTGCAACTGCCAGTGCAAAGGGTACATTGATA
AGAATTTTCAACACAATGGATGGAACTCGGTTACAAGAGCTACGAAGAGGAGTGGACAGAGCAAATATTTTTAGCATCAC
TCTTTCACCAAATGCGCAGTGGTTGGCTGTATCCAGTGACAAGGGTACTGTTCATATATTCAGTCTTAGAGTTCGAGTAT
TTGGAGATGACTCATCCTCTAATTCAAGTTCTGGTCAAGGTTCAGCACTTTTTAATCAGAATTCTTCAAATTCTCTTGAT
GCTCTTATTTCTCGGAATACTGGTGCCAATCCTGGTTCATCATTATCTTTTATGAGAGGGGTTTTACCTAAATATTTTAG
CTCGGAGTGGTCATTTGCACAGTTTCACTTACCGGAAGATACTCAGTTCATTGCAGCATTTGGGTCACAAAATACCGTTG
TTATTGTTGGCATGGATGGGAGTTTCTACAGGTGCAGTTTTGATCCTGTGCATGGAGGAGAGATGTTGCAGCAGGAGTAT
GTTAGCTTTCTAAAAACAGACAGACGGTCTGGATAG