Details for Papaya Locus evm.TU.supercontig_1.63

Position : sup1 ( 5`- 1210420 .. 1208460 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_1.63

Protein [Map View]
MSDVFEGYEQKKEKVSEIKSGIDEADVLIRKMDLEARSLQPSVKAMLLAKLREYKSDLNQLKREFKRVSSPNTNQVTREE
LLEAGMADPHAVSADQRERLTMSVERLNQSGDRIKESRRTMLETEELGVSILEDLHQQRQTLLHAHNKLHGVDDAIDKSK
KILSTMSRRITRNKWIVASVIAALVFAIILILFFKLK

DNA
ATGAGCGATGTCTTCGAAGGTTACGAACAGAAGAAGGAGAAGGTTTCTGAAATAAAGTCAGGAATAGATGAGGCTGATGT
TTTGATTCGAAAAATGGACCTTGAGGCAAGAAGTTTGCAGCCAAGTGTAAAGGCCATGCTTCTTGCTAAATTACGGGAGT
ATAAGTCTGACCTGAATCAGTTGAAGAGGGAATTCAAAAGAGTTTCATCACCTAATACTAACCAGGTTACACGGGAGGAG
TTGCTAGAGGCCGGCATGGCGGATCCACATGCGGTTTCTGCTGATCAAAGAGAAAGATTGACCATGTCAGTAGAGAGACT
GAATCAGTCAGGTGATAGGATAAAGGAGAGTAGAAGAACCATGCTGGAGACAGAAGAACTTGGTGTCTCAATCCTGGAAG
ATCTACACCAACAGCGGCAAACTCTCTTACATGCCCATAACAAGCTTCATGGGGTGGATGATGCCATTGACAAGAGTAAA
AAAATCTTAAGTACCATGTCCCGGAGGATTACTAGGAACAAATGGATTGTTGCTTCAGTCATTGCGGCTCTTGTTTTTGC
AATCATTCTCATCTTATTTTTCAAGCTTAAGTGA