Details for Papaya Locus evm.TU.supercontig_1.60

Position : sup1 ( 5`- 1190212 .. 1194738 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_1.60

Protein [Map View]
MILRSSQLLLLLAILGVLSPATHSLRFELQSGHTKCIAEDMKTNSMTVGKYSIVNPNEGTVLPQTHKLTVRVTSTQGNTY
HQADHVESGQFAFTAPEDGDYMACFWVLDQKPDITLTVDFDWKTGVQAKDWSNVAKKGQVDVMEIELKKLQDMVASIHEE
MFYLREREEEMQELNRSTNSRMAWLSFLSLFVCLSVAGLQIWHLKTFFEKKKLI

DNA
ATGATTCTTCGGTCGAGCCAACTGCTGCTTCTTCTCGCAATCCTAGGGGTTCTATCCCCTGCGACGCATTCACTCCGCTT
CGAACTGCAATCGGGTCATACCAAGTGCATCGCCGAAGATATGAAGACCAACTCCATGACTGTAGGCAAGTACAGCATAG
TCAACCCCAACGAAGGCACCGTCTTGCCCCAGACCCATAAGCTCACCGTCAGGGTCACATCGACACAGGGGAACACCTAT
CACCAAGCGGATCATGTGGAATCTGGGCAGTTCGCATTCACGGCGCCGGAGGATGGGGATTATATGGCCTGCTTTTGGGT
CCTTGATCAGAAACCGGATATCACGTTGACTGTTGATTTTGACTGGAAGACTGGTGTACAAGCCAAGGACTGGTCTAATG
TTGCCAAAAAGGGCCAAGTTGATGTAATGGAAATTGAGCTTAAGAAGCTGCAGGATATGGTCGCTTCCATTCATGAAGAG
ATGTTTTATCTCCGGGAAAGGGAAGAAGAAATGCAAGAACTGAACCGAAGTACCAACTCCAGAATGGCTTGGTTGAGTTT
CCTTTCACTTTTTGTTTGCTTGTCTGTTGCCGGCTTGCAAATATGGCACTTGAAGACCTTCTTCGAGAAAAAGAAGCTCA
TTTAA