Details for Papaya Locus evm.TU.supercontig_1.59

Position : sup1 ( 5`- 1112901 .. 1109246 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_1.59

Protein [Map View]
MKFGKEFASQMVPEWQEAYMDYGFLKKLLKDIQRFNHRNKPHPGSAAALTRKLTLYRAFSGLTLRHNPNYQAVSPTSSSD
VENQTILVNSVNRNGSERYQTTFLMAADEGGEYEFVYFRRLDDEFNKVDKFYRSKVKEVMNEAEILNKQMDALIAFRIKV
DNPTVTQWEERSAEMTRLASEVQTSTAALAANVPAGARAGSRRVYHEHMDVIDEEAGPSSHEQADDRKIKSSSNKNVAEN
HKVEEDKAKGISRAIRPAPLQILERVTMNNTLETPRSTIKNVLRVPNQEELKFTKDNLKKVQNQLKRAFIEFYLKLRLLK
SYSFLNTLAFSKIMKKYDKITSRNATKAYMEMVDNSYLGSSDEINKLMERVEATFIKHFANSNRSKGMSILRPKSKKERH
GVSFSTGFFAGCIASLIIALVLIIRARHILNKPGQVLYMETMFPLYSLFGFIVLHMIMYAANIYYWRKYRVNYSFIFSFK
RGTELGYREVLLLSFVLGVLALICVLLNLDMEMDPKTNDYKVITELLPLMLVVLVTVTLFCPFNILYRSSRFFLLTCLFH
CIAAPLYKVTLPDFFLADQLTSQVQAFRSLEFYVCYYGWGDYRLRENNCRSNDVFNTFHFIVAVIPYWSRLLQCLRRLFE
ERDPVQGYNGLKYFLTIVAVCLRTAYSLNKGFGWRIIAWIFSAIAAIFCTYWDLVHDWGLLQRRSKNFMLRDKLLISHKT
VYYAAMVLNVLLRFAWLQTVLNFQVSFLHRETLVAIVASLEIIRRGMWNFFRLENEHLNNVGKYRAFKSVPLPFNYDEDD
DKDD

DNA
ATGAAGTTTGGGAAAGAATTCGCGTCTCAAATGGTACCAGAATGGCAAGAAGCGTACATGGATTACGGATTTCTCAAGAA
ACTGTTGAAAGATATCCAACGCTTCAACCATCGAAACAAGCCGCACCCTGGTTCGGCAGCTGCTCTAACGCGCAAGCTCA
CTCTCTACAGAGCTTTCAGTGGCTTAACACTCCGGCACAACCCCAACTACCAGGCCGTCAGCCCTACCAGCTCCTCCGAT
GTCGAAAACCAGACCATCTTGGTTAACTCCGTCAATCGGAACGGCAGCGAGAGATACCAGACGACGTTCTTGATGGCGGC
CGACGAGGGAGGAGAGTACGAGTTTGTGTACTTCAGGAGACTGGACGATGAGTTCAACAAGGTTGACAAGTTTTACAGGT
CTAAAGTGAAGGAGGTGATGAATGAAGCGGAGATCTTGAACAAGCAAATGGATGCTTTAATTGCTTTTAGAATTAAAGTT
GATAATCCAACAGTGACTCAATGGGAAGAAAGATCTGCAGAGATGACTCGTTTGGCTTCCGAGGTTCAAACTTCAACTGC
AGCATTGGCTGCTAATGTTCCAGCTGGTGCTAGAGCTGGCAGCCGAAGAGTTTATCACGAGCACATGGATGTGATTGATG
AAGAAGCTGGGCCAAGCAGCCATGAACAAGCAGATGATAGGAAGATCAAGAGTAGTAGTAATAAAAATGTTGCAGAGAAC
CATAAAGTTGAGGAAGATAAGGCAAAGGGTATTAGTAGGGCGATAAGACCAGCTCCTTTACAAATACTTGAACGTGTGAC
GATGAACAATACTCTGGAAACTCCTCGTTCCACCATTAAAAATGTTCTCAGAGTTCCTAACCAAGAAGAGCTCAAGTTCA
CTAAAGATAATCTTAAAAAAGTCCAGAATCAACTCAAGCGTGCCTTCATTGAATTCTACCTCAAGCTTCGTCTTCTTAAG
AGTTACAGCTTTTTGAATACGCTAGCCTTCTCGAAAATCATGAAGAAATATGACAAGATAACTTCAAGGAATGCAACAAA
AGCTTACATGGAAATGGTGGATAACTCCTACCTCGGCAGCTCTGATGAGATTAACAAGCTTATGGAGAGGGTTGAAGCTA
CATTCATCAAGCATTTTGCAAACTCGAATCGTAGCAAAGGCATGAGCATCTTAAGGCCAAAATCAAAGAAGGAAAGACAT
GGAGTATCATTTTCAACAGGTTTCTTCGCTGGCTGCATTGCTTCTCTCATTATAGCCCTTGTCCTCATTATACGCGCTCG
GCATATATTAAACAAGCCTGGACAGGTGCTGTACATGGAAACCATGTTTCCTCTTTACAGCTTGTTTGGATTCATTGTTC
TGCACATGATCATGTATGCTGCCAACATATACTACTGGAGGAAATACCGAGTCAATTACTCCTTCATATTTAGTTTCAAG
AGAGGAACAGAGCTGGGTTACAGAGAAGTTCTTCTTCTAAGTTTCGTTCTTGGAGTATTAGCACTAATCTGCGTGCTTCT
AAACCTTGACATGGAGATGGATCCCAAAACAAATGATTACAAAGTCATTACTGAACTTCTTCCTCTCATGTTGGTTGTGC
TTGTCACTGTCACACTCTTTTGCCCTTTCAATATCTTGTATCGCTCAAGTCGCTTCTTTCTCCTCACATGTCTGTTTCAT
TGCATTGCTGCTCCTCTTTATAAGGTCACACTCCCTGATTTTTTCTTAGCAGATCAGCTTACTAGCCAGGTTCAAGCATT
TAGGAGCTTGGAGTTTTATGTGTGCTATTATGGATGGGGAGACTACAGACTCAGAGAAAACAATTGCAGAAGTAACGACG
TATTCAACACTTTCCATTTCATAGTTGCCGTGATTCCTTACTGGTCTCGTCTTCTCCAGTGTCTAAGGCGTCTGTTCGAA
GAGAGAGATCCGGTTCAAGGTTACAATGGTTTGAAATATTTCTTGACAATAGTAGCAGTTTGCCTCAGGACTGCTTACAG
TCTTAACAAAGGGTTTGGATGGCGAATCATAGCCTGGATTTTCTCAGCCATTGCAGCAATTTTCTGTACTTATTGGGACC
TTGTCCATGACTGGGGACTTTTGCAGCGACGCTCCAAGAACTTTATGTTGAGAGACAAGCTACTTATATCTCACAAAACT
GTATACTATGCTGCCATGGTTTTGAACGTTTTGTTGAGATTTGCATGGCTGCAAACGGTGTTGAATTTTCAGGTGTCTTT
CCTGCACAGAGAAACGTTGGTTGCCATTGTCGCGAGCCTGGAGATTATTCGTCGTGGAATGTGGAATTTTTTCCGATTGG
AAAACGAACACTTGAATAACGTGGGCAAGTATCGGGCATTCAAATCGGTTCCGCTGCCATTCAATTACGACGAAGATGAT
GATAAAGATGATTAG