Details for Papaya Locus evm.TU.supercontig_1.57

Position : sup1 ( 5`- 1103818 .. 1102367 -3` )
Annotation :
External links : CoGe
PGDD synteny : evm.TU.supercontig_1.57

Protein [Map View]
MEAVASSSAASAMKAVSFLATPLTPRIAVPSSLKSPTTKPYILTLHSSNPHLRGRPGVFCLPRCSSRPHNETSKETDRDS
TSEPHSFSKSQYPAMPLSTESISASSSPSSSRTGLVLDLGPSGSWDSAEIGSPVVKRFLSDEEERWYMWYDGHSWERSGS
DSIGLAVSSNGIHWERGQGAVKSSGDVGLVMSCGKDWWAFDTESIRPAEVVIMSSTKVRAASSVYWLYYTGYSNEKVDVL
DDSLGSYLENPERFRFDDKNDGKRRIPKSLPGLAISQDGRHWARIEGEHHSGALFDVGSDRDWDSLFIAAPQVVFHGNGD
LRMYYHSFDVENGEFGIGIARSRDGIKWVKLGKVIGGRRGFFDEFGAVNPCVVRNKKDGKYLMAYEGIGGDGERSIGLAV
SCEGLKDWRRVEDDDEAVLKAGEREEWDNKGVGSPCLIQMDGDVDEWRLYYRGIGNGGRSGIGMAVSEGSEARRFRRWTG
FHL

DNA
ATGGAAGCTGTTGCATCATCTTCAGCAGCGTCGGCAATGAAAGCTGTTAGTTTCCTTGCAACTCCTCTTACCCCGAGAAT
AGCTGTTCCATCTTCCTTAAAGTCACCCACGACAAAGCCCTACATTCTCACTCTTCACTCTTCAAACCCTCATTTAAGAG
GCAGGCCCGGTGTTTTCTGCCTACCCAGATGCTCGTCTCGCCCACACAACGAGACCAGTAAGGAAACAGACCGAGACTCA
ACCTCCGAGCCCCATTCCTTTTCAAAATCCCAGTACCCAGCGATGCCCCTTTCGACTGAATCAATTTCTGCATCTTCCTC
ACCGTCATCTTCCAGAACTGGATTGGTTCTTGATTTGGGTCCTTCAGGTTCATGGGACAGTGCAGAGATTGGGTCGCCGG
TGGTGAAGAGATTTCTCAGTGACGAAGAAGAGAGGTGGTACATGTGGTATGACGGGCATTCTTGGGAAAGATCGGGTTCG
GATTCTATTGGATTAGCTGTTTCAAGCAATGGGATTCATTGGGAGAGAGGTCAAGGCGCAGTAAAATCAAGTGGGGATGT
TGGTCTGGTGATGAGTTGCGGTAAAGATTGGTGGGCATTTGATACGGAGAGCATTAGGCCTGCCGAGGTTGTCATCATGT
CAAGTACAAAAGTTAGAGCCGCTAGTTCTGTTTATTGGCTCTACTACACCGGTTACAGCAATGAGAAAGTAGATGTATTG
GATGATTCTTTGGGATCCTATTTAGAAAACCCAGAGAGATTTCGCTTTGACGATAAAAACGACGGAAAAAGGAGGATTCC
AAAGTCCTTGCCTGGTCTAGCAATAAGCCAGGACGGGAGGCATTGGGCTAGAATTGAAGGGGAACATCATAGCGGAGCAC
TGTTTGATGTGGGATCTGATAGAGACTGGGATTCACTGTTTATAGCCGCACCGCAAGTTGTTTTCCATGGAAACGGTGAT
CTTAGGATGTATTATCACTCGTTTGACGTTGAAAATGGAGAGTTTGGGATTGGCATTGCTCGGTCCAGAGATGGAATCAA
ATGGGTTAAACTGGGAAAGGTCATAGGAGGAAGAAGAGGGTTTTTTGATGAGTTTGGAGCAGTGAACCCTTGTGTTGTGA
GGAACAAGAAAGATGGCAAGTACTTGATGGCATATGAAGGTATTGGAGGAGATGGGGAGAGGAGCATTGGATTGGCAGTG
TCCTGTGAAGGGTTGAAGGATTGGAGGAGGGTGGAAGATGATGATGAGGCAGTGCTTAAGGCAGGGGAGAGAGAAGAATG
GGATAATAAGGGGGTTGGATCACCTTGTTTGATCCAAATGGATGGAGATGTTGATGAGTGGAGACTGTACTACAGAGGTA
TTGGAAATGGAGGAAGAAGTGGGATTGGCATGGCAGTTTCTGAGGGAAGTGAAGCCAGAAGGTTCAGAAGATGGACAGGG
TTTCATTTATAA