Details for Lotus Locus chr2.CM0641.300.nc

Position : chr2 ( 5`- 182300 .. 183745 -3` )
Annotation :
External links : CoGe
PGDD synteny : chr2.CM0641.300.nc

Protein [Map View]
MALPSLKPHNPISKLSIFQRSTIPTTLIPSWASLVSSNPALSPKFQSFLRCSTKPDTSANSEIHSEQNDEPSSVSNSQNQ
KASEPGEASVAFSSSSPPVDSSSSYACSRGLVFDLGPSNSWDGAEIGSPVVKRFLSDEEERWYMWYHGRSEGDSSSGLIG
LAISSNGVHWERGGGPSRSSSDVGSVMNCGKDWWVFDTHGVRPSETVIMSSSRVRAPPGVYWLYYTGYSSETAEVTDHSM
EFCLENPDRCLINDGVNQGECGKWNVLKSLPGLAISQDGRHWARIEGEHHSGALIDVGSEKDWDSLFISSPHVVYHENGD
LRMYYHSFDLEKGHFAVGIARSRDGVRWVKLGKVIGGGKTGSFDEFGAMNPCVMRNRFEWNYMMAYEGVAADGRRSIGMA
ISPNGLKEWVRLQDEAILEPSDRGCWDDKDVGSPCLVQMDKEENELRLYYRGVGNEGRVGIGMAVSEGKDVRSFRRWTGF
HL

DNA
ATGGCACTTCCCTCCTTGAAACCACACAACCCCATCTCAAAACTTTCCATTTTCCAACGTTCCACCATCCCAACAACGTT
AATCCCATCATGGGCATCCTTGGTTTCCTCAAACCCTGCCCTCTCCCCAAAGTTTCAATCATTCTTACGCTGCTCCACGA
AACCAGACACCAGCGCCAACAGCGAGATACACAGCGAGCAAAACGATGAACCCAGTTCAGTTTCCAATAGCCAGAACCAG
AAGGCATCAGAACCAGGTGAAGCAAGTGTAGCGTTTTCTTCTTCTTCACCACCTGTGGATTCTTCTTCTTCTTATGCTTG
TTCAAGAGGGTTGGTGTTTGATTTGGGTCCTTCGAACTCGTGGGACGGTGCAGAGATTGGATCGCCGGTGGTGAAGAGGT
TTTTGAGTGATGAGGAGGAGAGATGGTACATGTGGTATCATGGAAGGTCTGAAGGGGACTCATCTTCTGGTTTGATTGGG
TTGGCTATTTCCAGCAATGGGGTTCATTGGGAGCGTGGAGGAGGGCCTTCTAGATCAAGTTCTGATGTGGGTTCTGTGAT
GAATTGTGGTAAGGATTGGTGGGTTTTTGATACTCATGGAGTTAGACCATCTGAGACGGTGATCATGTCTAGTTCTAGAG
TTAGAGCTCCTCCTGGTGTTTATTGGCTTTACTATACTGGCTATAGCTCTGAGACTGCAGAGGTTACTGATCACTCTATG
GAATTCTGTTTGGAAAATCCGGATAGGTGTCTCATCAATGATGGTGTGAATCAAGGGGAATGTGGTAAGTGGAATGTTTT
GAAGTCATTGCCTGGTTTGGCTATTAGTCAAGATGGGAGGCATTGGGCTAGGATTGAAGGAGAGCATCATAGTGGGGCAT
TGATTGATGTTGGGTCTGAGAAAGATTGGGATTCTTTGTTTATTTCTTCTCCACATGTGGTTTACCATGAGAATGGGGAC
CTCAGGATGTATTATCATTCATTTGATTTGGAAAAAGGGCACTTTGCTGTTGGGATTGCTAGGTCAAGAGATGGAGTCAG
GTGGGTGAAGTTGGGGAAAGTAATAGGGGGAGGAAAAACTGGTTCTTTTGATGAGTTTGGAGCAATGAATCCGTGTGTGA
TGAGGAACCGGTTTGAGTGGAACTATATGATGGCATATGAAGGTGTTGCTGCTGATGGAAGGAGGAGCATTGGGATGGCT
ATTTCTCCTAATGGGTTGAAGGAATGGGTGAGGCTTCAAGATGAGGCAATTTTGGAGCCATCAGATAGAGGTTGTTGGGA
TGATAAGGATGTGGGATCCCCATGTCTTGTTCAAATGGATAAAGAAGAAAATGAGTTGAGGTTGTACTATAGAGGTGTTG
GAAATGAAGGAAGAGTTGGAATAGGAATGGCCGTTTCTGAAGGGAAGGATGTTAGAAGTTTTAGAAGATGGACAGGTTTT
CATTTATAA