Details for Lotus Locus chr2.CM0641.270.nc

Position : chr2 ( 5`- 169043 .. 164408 -3` )
Annotation :
External links : CoGe
PGDD synteny : chr2.CM0641.270.nc

Protein [Map View]
MTFKKDFKQQMVPEWEKDYMDYEGLKRILKEVKSSKQTTYNRSLHHRFSIERALSGIHMHGSNHQVEGDIEDQVIDVKTL
EQDGSKQVYETNFQKEHEEGGQAESRFFQKLDEELNKVNAFYKDQVEADKHEATLLSKQVEALVAFRVKVKNPDQGLQQM
TSTSKEKMDQNHQQKDSMGGTEVDPVQQASRDTHPEEEAHKNYQRRDPMEILENVRIDNATQSPISTIKSVFTDSNDDEL
SFNKEELRKIEGQLKLVFIEFYQKLLHLKDYSFMNLSAFSKIMKKYEKITSRTASMAYMRVVDNSYLGSSDEVNFLLEKV
ESTFIRNFSNSNHKKGRKLLRSKMKRERHSITFFTGFFSGCFVALLAATILRIVSQRLMQNKVGTFYMENIFPLYSLFGY
ITLHMLMYAANTYYWKRYRVNYPFLFGFRPGTELDHREVFLLTTGHAVVAVLCFLINLQLEMNQNTRSYKTATELVPLSL
VVLVLLITFCPFNIVYRSSRFFFIKCLFRCICAPLFPVTLADFFLADQLTSQFQAFRSFVLYICYYGLGERSRRESKCQG
YGFYNGLYVMVGVIPYWFRLAQVSHTLVTFVQCMRQLYEDRDMDHAINGSKYLSTIVAVIIRTAFERKKGSTWKVLALIS
SVVTIMLNTYWDIVKDWGLLQRHSKNPYLRDKLVVPHKSVYFLAMVLNVVLRLCWAQLVLELNWKPLHKVAITTFISCLE
IIRRGIWNFFRLENEHLNNVGNYRAFKSVPHPFSYYDDKNDKDD

DNA
ATGACATTTAAGAAAGACTTCAAACAACAAATGGTGCCAGAGTGGGAGAAAGATTACATGGACTATGAAGGCCTCAAAAG
AATATTGAAAGAGGTCAAAAGCAGCAAGCAAACTACATACAACAGGTCCTTGCATCACAGATTTAGCATTGAAAGAGCAT
TAAGTGGAATACACATGCATGGTAGCAATCATCAGGTAGAGGGGGATATTGAAGACCAGGTTATAGATGTTAAGACATTA
GAGCAAGATGGTTCCAAACAGGTATATGAGACCAACTTTCAAAAGGAACATGAAGAAGGAGGACAAGCTGAGTCAAGATT
CTTTCAGAAGCTTGATGAGGAGCTCAACAAGGTCAATGCCTTCTACAAGGATCAGGTGGAGGCAGACAAGCATGAAGCAA
CACTTTTGAGTAAACAAGTAGAGGCTTTAGTTGCCTTCAGGGTAAAGGTTAAAAACCCTGATCAAGGATTGCAGCAGATG
ACTTCAACATCTAAAGAGAAAATGGATCAGAATCATCAGCAAAAAGACTCCATGGGTGGAACTGAAGTTGATCCTGTTCA
ACAGGCCAGTAGAGATACTCATCCCGAGGAGGAAGCACACAAGAATTACCAAAGAAGAGATCCCATGGAGATCCTTGAGA
ATGTAAGGATTGATAATGCTACTCAATCTCCAATATCAACAATTAAAAGTGTATTTACAGATTCCAATGATGATGAATTA
AGTTTCAACAAAGAAGAGCTGAGAAAAATTGAAGGGCAACTGAAACTTGTCTTTATTGAGTTCTATCAGAAACTCCTACA
TCTCAAAGATTACAGTTTTATGAACCTCTCAGCATTTTCTAAGATCATGAAGAAGTATGAAAAGATTACATCAAGAACAG
CATCAATGGCATACATGAGAGTAGTGGATAACTCCTATCTGGGAAGCTCTGATGAGGTTAATTTTCTTTTGGAGAAGGTG
GAGTCTACCTTCATCAGGAACTTCTCAAATTCAAATCACAAAAAGGGAAGAAAATTATTAAGGTCAAAAATGAAAAGAGA
AAGGCACAGCATAACATTTTTTACAGGTTTCTTTTCTGGTTGCTTTGTTGCCCTTTTAGCTGCTACTATTTTAAGAATAG
TATCTCAACGATTAATGCAGAACAAAGTGGGGACATTTTACATGGAAAACATTTTCCCACTATACAGTCTATTTGGATAT
ATCACTCTACATATGCTTATGTATGCTGCAAACACATACTATTGGAAGCGTTATCGGGTGAATTATCCATTCTTATTTGG
CTTCAGGCCTGGAACTGAGTTGGATCATAGAGAAGTGTTCCTTCTTACCACTGGTCATGCAGTGGTTGCAGTGCTATGTT
TCTTGATAAATTTGCAGCTGGAAATGAACCAAAATACTAGAAGCTACAAGACGGCCACTGAACTTGTTCCTCTGAGCTTA
GTTGTTCTTGTTCTTTTGATCACCTTTTGCCCTTTCAACATTGTATACCGTTCAAGTCGTTTCTTCTTCATCAAGTGTTT
ATTTCGTTGCATATGTGCCCCTCTTTTCCCGGTAACACTTGCAGATTTCTTCTTAGCTGATCAGCTTACAAGCCAGTTCC
AAGCCTTCAGGAGTTTTGTGCTTTACATATGCTATTATGGCCTTGGAGAACGTTCAAGGAGGGAAAGCAAATGCCAAGGT
TATGGTTTCTACAATGGACTGTATGTCATGGTTGGAGTCATTCCTTATTGGTTTCGCCTCGCACAGGTATCTCATACACT
AGTAACATTTGTGCAGTGCATGCGTCAATTGTATGAAGACAGAGATATGGACCATGCAATCAATGGTTCAAAGTATCTTT
CAACAATTGTTGCCGTGATCATAAGGACTGCCTTTGAAAGAAAGAAGGGAAGCACTTGGAAAGTGTTGGCACTCATAAGT
TCAGTTGTGACAATAATGCTGAACACATATTGGGACATCGTCAAAGATTGGGGGCTTCTGCAGAGGCACTCAAAGAATCC
CTATTTGAGAGATAAACTAGTAGTTCCACATAAAAGTGTTTACTTCTTAGCCATGGTCCTGAATGTAGTTCTTAGACTTT
GCTGGGCGCAGTTGGTGCTTGAACTCAACTGGAAACCTCTTCATAAAGTGGCAATCACAACATTTATTTCCTGCCTTGAA
ATCATTCGCCGTGGCATTTGGAACTTCTTTAGGTTGGAGAACGAGCACTTGAACAATGTTGGAAACTACCGTGCCTTCAA
GTCGGTTCCTCATCCTTTCAGTTACTATGATGACAAAAATGACAAAGATGACTAG