Details for Cacao Locus Thecc1EG018650

Position : scaf_4 ( 5`- 17017477 .. 17020381 -3` )
Annotation :
External links : CoGe
PGDD synteny : Thecc1EG018650

Protein [Map View]
MSRLTQGIVLIILGLMLETDIGESMRFELESGNTKCISEDIKPNAMSVGKYSIVNPNEGYPLPDSHRLTLRVTSPYGNNN
HYGDRVDSGTFAFTAVEGGDYTACFWATDHKPPVTITIDFDWKTGVAAKDWSKVAKKGQVETMKLELKKLYDTVTSIHEE
MFYLREREEEMQQLNRETNSKMATLSFFSLVVCLSVAGLQIWHLKAFFERKKLL*

DNA
ATGTCTAGATTAACTCAGGGTATAGTTCTCATAATCCTAGGATTAATGTTGGAAACAGACATTGGGGAATCAATGAGATT
TGAGTTGGAATCAGGGAACACAAAGTGCATTTCAGAAGACATCAAGCCGAATGCAATGAGTGTTGGTAAATACAGCATTG
TCAATCCAAACGAAGGTTACCCTTTGCCTGATTCCCACCGACTCACTCTCAGGGTGACTTCACCTTATGGGAACAATAAT
CACTATGGAGATCGTGTGGATTCAGGGACTTTTGCGTTTACTGCAGTTGAGGGTGGTGATTACACTGCTTGTTTTTGGGC
TACTGACCACAAGCCTCCTGTAACGATTACAATTGATTTTGATTGGAAAACTGGTGTTGCTGCTAAGGATTGGTCCAAGG
TTGCCAAGAAAGGGCAGGTTGAAACAATGAAACTTGAGTTGAAGAAATTGTACGACACTGTCACGTCTATTCATGAAGAG
ATGTTTTATCTTCGTGAGAGGGAGGAAGAAATGCAACAGCTTAATAGAGAAACAAATTCCAAAATGGCTACTCTTAGTTT
CTTTTCGCTTGTTGTTTGCTTGTCTGTGGCTGGGTTGCAGATATGGCATCTAAAGGCATTTTTTGAGAGGAAGAAGCTCC
TGTAG