Details for Cacao Locus Thecc1EG013003

Position : scaf_3 ( 5`- 8262057 .. 8263341 -3` )
Annotation :
External links : CoGe
PGDD synteny : Thecc1EG013003

Protein [Map View]
MAVVRERRQVNLRLPLPDLSDRCSRFPLPLPPSASTTAAAASASVTISQTELEKLQVLGHGNGGTVYKVQHKRTSKIYAL
KVVNGDSDVTVHRQVSREMEILRRTDSPHIVRCYGTYVKPSGDVAILMEYMDAGTLDTLLRTRGTFSEPELAHITRQILK
GLTYLHAHKIIHRDLKPSNLLVNKNMEVKIADFGVSKIMSRRLDPCNSYVGTCAYMSPERFDPDAHGGNYDGYLGDIWSL
GLTLMELYVGHFPFLSPDQRPDWATLMCAICFGDPPTLPQGASDEFRSFIECCLQKESSKRWTASQLLDHPFLRSHPTSD
*

DNA
ATGGCAGTAGTTCGTGAACGCCGACAGGTTAATCTCCGCCTTCCGCTTCCTGACCTCTCCGATCGCTGCTCTCGCTTTCC
TCTCCCACTCCCTCCTTCCGCTTCCACAACCGCCGCCGCCGCTTCTGCTTCAGTTACTATTTCCCAAACGGAGCTCGAGA
AGCTCCAAGTGCTCGGCCATGGTAACGGTGGCACTGTTTATAAAGTACAACATAAACGCACCTCCAAGATTTATGCCTTG
AAAGTGGTTAACGGCGACAGCGATGTGACTGTTCACAGACAAGTTTCGAGAGAGATGGAGATTCTACGACGGACGGATTC
CCCTCACATCGTTCGTTGCTACGGAACATACGTGAAGCCTTCTGGGGATGTTGCTATACTCATGGAGTACATGGACGCCG
GCACTTTGGATACCCTCCTCCGTACCCGCGGTACCTTCTCAGAGCCTGAACTGGCTCATATAACCAGACAAATTCTGAAA
GGCTTGACTTACTTACATGCCCATAAAATCATTCACCGAGACCTCAAGCCTTCGAATCTGTTGGTGAACAAGAACATGGA
GGTGAAAATAGCTGATTTTGGAGTGAGCAAGATTATGTCTCGGAGGTTGGATCCATGCAACTCTTACGTCGGAACCTGCG
CTTACATGAGTCCCGAAAGGTTCGACCCTGACGCCCATGGAGGTAATTACGATGGTTACCTTGGAGATATATGGAGCTTG
GGGCTTACTTTAATGGAACTTTATGTGGGTCACTTTCCGTTCCTGTCGCCGGATCAAAGACCCGACTGGGCAACCCTGAT
GTGTGCAATTTGCTTCGGGGATCCACCGACCTTGCCACAGGGTGCTTCCGATGAGTTCAGGAGCTTCATTGAGTGTTGCT
TGCAGAAGGAGTCTAGTAAGAGGTGGACGGCCTCTCAGCTTTTGGATCACCCGTTTCTGCGTAGTCATCCGACGTCCGAT
TAG