Details for Cacao Locus Thecc1EG011655

Position : scaf_2 ( 5`- 41134753 .. 41136666 -3` )
Annotation :
External links : CoGe
PGDD synteny : Thecc1EG011655

Protein [Map View]
MALRLTLLKRTGVDSGSVLGLRRWVHASALPPPLDAPMSLPTALQPLVLPESDQIPDSNTNKDIGFGFGFPSFVFGGSIE
LMAVPKKKVSRHKRGIRNGPRALKPVPVIIRCNLCLVRDILATFVLCFRILGVINLGFSYTIESVPFMTFKQNKQIVIGS
VVELSCHTSSVAVEIEERRVNKGTHLVKHVVSVGGKIEINK*

DNA
ATGGCGTTGAGACTAACGTTACTGAAGCGCACCGGCGTAGACTCCGGTTCCGTTTTGGGGCTGAGGAGGTGGGTACATGC
TTCAGCTCTCCCTCCACCGTTGGACGCTCCCATGAGCCTGCCCACCGCATTGCAGCCGTTGGTTTTGCCCGAGTCTGATC
AAATCCCAGACAGCAATACCAATAAAGACATCGGGTTCGGATTCGGGTTTCCAAGTTTCGTTTTTGGAGGATCCATAGAG
CTCATGGCTGTCCCCAAGAAGAAAGTGAGTCGCCATAAGAGAGGCATAAGAAATGGACCCAGAGCTTTGAAACCTGTTCC
TGTGATTATTAGATGCAATCTTTGCTTAGTCAGGGACATTCTTGCTACATTTGTTCTATGCTTTAGAATTCTTGGTGTGA
TAAACCTTGGTTTTTCTTACACAATAGAATCTGTGCCGTTCATGACTTTCAAACAAAACAAACAAATTGTCATCGGATCT
GTGGTCGAGTTAAGTTGCCACACTTCTTCTGTTGCAGTGGAGATCGAGGAAAGGAGGGTGAACAAGGGGACTCATCTGGT
TAAGCATGTTGTGTCTGTTGGTGGGAAAATAGAGATAAACAAGTAG