Details for Cacao Locus Thecc1EG011640

Position : scaf_2 ( 5`- 41089240 .. 41092096 -3` )
Annotation :
External links : CoGe
PGDD synteny : Thecc1EG011640

Protein [Map View]
MILRSLPIVVLVLGILSPATQSLRFELQSGQTKCISEDIKSNSMTVGKYHVVNPNEGHPLPDSHKLTVRVTSTYGNSFHS
AEKVETGQFAFTAAEAGDYMACFWAPVHSPQITITVDFDWRTGVHAKDWSNVAKKGQVDVMELELKKLYDTVTSIHEEMF
YLREREEEMQELNQATTSKMFWLSFLSLFLCLSVAGMQFWHLKTFFEKKKLI*

DNA
ATGATTCTTCGGTCGCTTCCAATCGTGGTTCTGGTGCTGGGGATTTTATCCCCTGCGACGCAATCGTTACGGTTCGAGCT
GCAATCAGGACAGACTAAGTGCATCTCCGAAGACATCAAGAGCAATTCAATGACGGTCGGGAAGTACCACGTTGTCAATC
CCAACGAGGGTCACCCTTTGCCTGATTCTCACAAGCTCACCGTCAGGGTAACGTCGACGTATGGGAATAGTTTCCACTCG
GCGGAGAAAGTGGAGACAGGGCAGTTTGCGTTTACGGCGGCGGAGGCGGGTGATTACATGGCTTGCTTTTGGGCGCCGGT
TCATTCGCCGCAGATTACGATAACCGTTGATTTTGATTGGAGGACTGGAGTCCACGCTAAGGACTGGTCCAACGTTGCCA
AGAAAGGCCAAGTCGATGTCATGGAACTGGAGCTGAAGAAGTTGTATGATACTGTTACTTCCATTCATGAGGAAATGTTT
TATTTGCGGGAAAGAGAAGAAGAAATGCAGGAGCTGAACCAAGCTACTACCTCCAAAATGTTCTGGTTGTCCTTCCTCTC
ACTGTTTCTTTGTTTGTCAGTAGCAGGAATGCAATTTTGGCACTTGAAAACCTTCTTTGAGAAAAAGAAGCTCATATAA