Details for Cacao Locus Thecc1EG011630

Position : scaf_2 ( 5`- 41033432 .. 41037074 -3` )
Annotation :
External links : CoGe
PGDD synteny : Thecc1EG011630

Protein [Map View]
MESLRHEKIQKFEEFVDRRLKPDLVRAIAERDKVFEQQKIFSDLRKNIENLEKNSVTSLRTLVNLGSEVYMQAEVPDTQR
IFVDIGLGFHVEFTWSEALKFISLREEKLESLPVCQGTDWLVIVVSFSILKFSINHHRSSIVEVITEGTWNRLWQIEEYT
CLIASIKAQIKLVALTMSHINPDYRTLLTMRSLLNPFWAGAEGGSSLPAEDMGRSNRISMARGEKLMALRSLLLSWIGLN
LLISSPVLLDSVPVVKHEETSKRSRHESLHCVKSYRMDGTVQETPFKSLSLSPSAFVLGRGMIPTVGFINQHLTVDAHIS
EKQWGDGRGPDCPLYQNKVTVARWYRISTRPCYREGVRVLEIG*

DNA
ATGGAGAGCTTACGCCATGAGAAAATACAGAAATTCGAGGAATTTGTTGATCGACGCCTTAAACCAGATCTTGTTCGTGC
TATTGCTGAACGGGACAAGGTCTTTGAACAGCAAAAAATCTTCTCAGATTTGCGAAAGAACATAGAAAATTTAGAGAAAA
ACAGTGTAACTAGTCTTCGAACATTGGTTAATCTTGGGTCAGAAGTGTATATGCAAGCAGAAGTGCCAGATACACAACGT
ATATTTGTGGATATTGGACTAGGATTTCATGTGGAGTTCACCTGGTCGGAAGCCTTAAAGTTCATCTCATTGAGGGAGGA
AAAGTTGGAAAGCTTGCCTGTATGTCAAGGAACAGATTGGCTAGTTATTGTTGTTTCGTTCTCCATTTTAAAGTTTAGCA
TCAATCATCATCGTAGTTCCATAGTAGAGGTTATAACTGAAGGAACATGGAACAGGCTTTGGCAAATAGAGGAGTATACC
TGCTTGATAGCATCGATTAAAGCCCAGATTAAGCTGGTGGCATTAACTATGAGTCATATAAACCCTGACTACAGAACTCT
ACTTACAATGAGAAGCTTGCTGAATCCTTTTTGGGCTGGGGCTGAGGGGGGATCAAGCCTGCCTGCAGAGGACATGGGCC
GTAGCAATAGGATATCCATGGCTCGAGGTGAAAAACTGATGGCTCTTAGATCGCTATTGCTAAGCTGGATTGGCCTGAAT
TTGCTGATTTCTTCCCCAGTTTTGTTAGATTCTGTTCCCGTTGTGAAACATGAAGAGACAAGTAAGAGAAGTAGGCATGA
GTCGCTTCATTGTGTAAAATCCTACAGGATGGACGGGACAGTACAGGAAACTCCATTTAAGAGTCTCTCTCTCTCTCCGT
CTGCATTTGTATTAGGTCGAGGGATGATTCCGACCGTCGGATTCATCAATCAACATCTTACAGTTGACGCTCATATTTCA
GAGAAACAGTGGGGGGACGGACGGGGACCCGACTGCCCTTTGTATCAGAATAAGGTTACTGTAGCACGATGGTATAGGAT
CAGCACTAGACCTTGTTATCGAGAAGGTGTTCGAGTGTTAGAAATCGGTTAG