Details for Cacao Locus Thecc1EG011629

Position : scaf_2 ( 5`- 41030735 .. 41032451 -3` )
Annotation :
External links : CoGe
PGDD synteny : Thecc1EG011629

Protein [Map View]
MEIASVTSPRMRLDHLEKEGSKETHGESFELDSSRNVSDHNHQFHSMNALEILRETVRILRYNSSGFMIIAALLICPVSA
VLMSNLLVDHSIVKRFTVRLLLVAKTSGLPLRSFLKQSCQRFAETAVSSAMCFPLFITLSLLSKAAVVYCVDCTYSRKSA
DVSKFFVIIRKFWRRLVSTYVWMCMVIVGCVTTFFVFLVAACSVLSVIGFTPDLIVYAVIMMGLVFSVVFANAIVVCNIG
IVICVLEEVSGLQALLRAGVLIKGQTQVGLLIFLGSTIGLAFVEGLFEHRVKTLSYGDGSSRIWEGPLLVIMYSFVVLVD
SMMNTVFYFSCRSYSVEASDGECRSMLETITVSAESLGVQ*

DNA
ATGGAGATTGCTAGCGTTACTTCTCCACGAATGAGATTAGATCACCTAGAAAAAGAAGGATCGAAGGAAACCCATGGGGA
AAGTTTTGAGCTAGACTCATCTCGTAATGTTAGTGATCATAACCACCAATTCCATTCCATGAATGCATTAGAGATCTTAA
GAGAAACCGTTAGGATTTTAAGGTACAATTCGTCCGGTTTTATGATCATTGCAGCTTTGTTAATTTGCCCAGTATCTGCA
GTACTTATGTCAAATTTGTTAGTTGATCATTCCATTGTGAAGAGATTTACTGTTAGGCTTTTGTTAGTTGCCAAAACCAG
TGGACTCCCATTGAGATCTTTCCTCAAACAGTCGTGCCAACGTTTTGCTGAGACGGCTGTTTCCTCAGCAATGTGCTTCC
CTTTGTTCATCACATTGTCTTTGTTATCAAAAGCCGCGGTGGTTTATTGTGTAGATTGTACTTATTCAAGGAAATCAGCT
GATGTTTCGAAGTTTTTTGTGATAATTCGGAAGTTTTGGAGGCGGCTTGTTTCTACGTATGTGTGGATGTGTATGGTAAT
TGTTGGTTGTGTAACAACTTTCTTCGTTTTTCTTGTTGCGGCATGTAGCGTACTTTCTGTCATTGGTTTTACACCTGATT
TAATTGTGTATGCGGTGATTATGATGGGGCTAGTGTTCTCGGTTGTTTTTGCCAATGCTATTGTTGTCTGCAATATTGGG
ATTGTAATCTGTGTGTTGGAGGAGGTTTCCGGACTTCAGGCATTGCTTCGTGCTGGTGTTCTAATCAAGGGGCAGACTCA
GGTTGGTCTTTTGATATTTCTTGGATCTACAATTGGGTTGGCATTTGTGGAAGGGTTGTTTGAACATAGGGTAAAGACGT
TGAGTTATGGAGATGGATCTTCTAGGATCTGGGAAGGGCCTCTGTTGGTTATAATGTATTCATTTGTGGTGCTTGTTGAT
TCCATGATGAATACAGTTTTCTATTTCAGTTGCAGATCTTATAGTGTCGAAGCCTCAGATGGTGAATGTCGATCAATGTT
GGAAACTATAACTGTTTCTGCTGAATCATTGGGTGTTCAATGA