Details for Western poplar Locus Potri.012G058800

Position : Chr12 ( 5`- 6110793 .. 6115614 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G058800

Protein [Map View]
MANSMAVLSRRLYRSLLSSNPKISQLSMPFCTSSSTTTTTTTTNNLSFREEESELDGSDTHSVPNSTTSSSPSSSTTTSE
GSSGSRMVQDRPLENGLDAGVYKAILVGQVGQNPLQKKLRSGREITIFSMGTGGIRNNRRPLQNEDPREYANRCAVQWHR
VSVYPERLGRVVMQNVLPGSILYVEGNLETKVFTDPITGLVRRIREIAVRQNGRLVFLGKGANDQQASSLELKGLGYY*

DNA
ATGGCAAATTCAATGGCTGTTCTCTCACGCAGGCTTTACCGTTCCCTTCTCTCATCAAACCCAAAAATTTCACAGCTTTC
AATGCCCTTTTGCACCTCCTCCTCCACCACCACCACCACCACCACCACTAACAACCTCTCTTTTCGTGAAGAAGAGTCTG
AATTGGACGGCTCAGACACTCACTCAGTCCCCAACTCAACCACCTCAAGTTCACCATCATCATCAACAACAACATCTGAA
GGATCGAGCGGGTCACGAATGGTCCAGGATCGTCCCCTTGAAAATGGCCTTGATGCTGGCGTTTACAAGGCGATATTGGT
GGGGCAGGTGGGGCAGAATCCATTGCAGAAGAAGTTGAGGAGTGGGAGGGAGATAACGATTTTCTCAATGGGGACAGGTG
GGATTCGCAATAATCGAAGGCCATTGCAGAATGAGGATCCAAGGGAGTATGCAAATAGGTGTGCTGTTCAGTGGCATCGA
GTTTCAGTCTACCCAGAGAGATTAGGTCGTGTTGTAATGCAGAATGTTTTGCCCGGTTCAATTCTATATGTGGAGGGGAA
TCTGGAGACTAAAGTCTTCACTGATCCAATAACTGGTCTTGTACGACGTATAAGAGAAATTGCAGTTCGTCAAAATGGTC
GGCTTGTCTTTCTGGGAAAAGGTGCCAATGATCAGCAAGCCAGTTCATTGGAGTTGAAAGGTCTTGGCTATTACTAG