Details for Western poplar Locus Potri.012G056000

Position : Chr12 ( 5`- 5766924 .. 5778933 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G056000

Protein [Map View]
MGRTRKGKAGFKVEDVLEVFNHLLEEKPSFAFLIPLILVCWGIEKWVFSFSNWVPLVVAIWATFQYCSHQQKVIVEDLNK
KWKRVVLNTSPITPLEHCEWLNKLLMEIWMNYMNPKLAIRFSSIVEKRLKQQRLKLMEKLELQEFSLGSCPPSLGLHGTR
WSTSGDQRIMHLGFDWDSKDMSILLLAKLAKPLMGTARIVINSLHIKGELLLMPVLDGRAVLYSFVSIPEVRIGVAFGSG
GSQSLPATELPGVSSWLVKVFTDTLVKTMIEPRRRCFSLPAVDLRKKAVGGIVYVSVISASKLSRSNLRGSPPRRVNGSF
IEHFDDKYLQTFVEVELGHLTRRTDVRPGSNPRWDSTFNMFLHEETGTLRLHLYNRPPNSVKYDYLASCEIKMKYVADDS
TTFWAIGPDSGVIAKHAEICGKEVEMVVPFEGVTSGELTVKLVVKEWLFSDGSHSLNNVSSQKSIYGSSNILSRTGRKIN
VAVMEGKGLISKERSGKCDPYVKLQYGKVLQKTRTAHSSNPLWNQKFEFDEIVDDRCLKIKCYSEEIFGDESIGSARVNL
EGLMEGFIRDMWVPLEKVNTGELRLQIEAVQVNDSEGSRGSMSGSFNGWIELVLVEAKDLIAADLRGTSDPYVRVQYGSL
KKRTKVMYKTLNPHWNQTLEFPDDGSPLELHVKDYNALLPTYSIGDCVVEYQGLPPNQMSDKWIPLQGVTRGEIHVRITR
KVPELQARNSLESDTSLIKSHQISNQMKQLMIKFQSLIEEGSLEGLSTALSEMQSLEDMQEEYMVQIETEQMLLLNKIKE
LGQEIMSSSSSLSRRSSGL*

DNA
ATGGGAAGAACAAGAAAGGGTAAAGCTGGTTTCAAAGTTGAAGATGTTTTGGAGGTCTTTAATCATCTGTTGGAGGAAAA
GCCTTCTTTTGCTTTCTTAATCCCTTTGATTTTGGTTTGTTGGGGAATTGAGAAATGGGTTTTCTCTTTCTCCAATTGGG
TTCCTCTTGTCGTTGCTATCTGGGCTACTTTTCAGTATTGCAGTCATCAACAGAAAGTTATTGTGGAAGACCTAAACAAA
AAGTGGAAGCGAGTTGTATTGAACACCTCGCCAATAACACCATTGGAACACTGTGAGTGGCTGAACAAGCTGTTGATGGA
AATTTGGATGAACTATATGAACCCAAAGCTTGCAATAAGATTCTCATCCATTGTTGAGAAACGATTGAAACAACAAAGGT
TGAAGCTCATGGAAAAACTCGAGTTGCAGGAATTTTCACTTGGTTCATGCCCACCATCCCTTGGTCTTCATGGGACTCGC
TGGTCAACTTCTGGTGATCAGAGAATTATGCATTTGGGATTTGATTGGGACTCCAAAGACATGAGCATTTTGTTGCTGGC
TAAGCTGGCAAAGCCATTAATGGGAACTGCTCGGATTGTTATAAACAGCCTCCACATCAAGGGTGAGCTTCTCTTGATGC
CAGTTCTGGATGGGAGAGCGGTTTTGTACTCATTTGTGTCAATTCCTGAAGTAAGAATAGGAGTTGCCTTTGGAAGTGGA
GGAAGCCAGTCATTACCTGCCACCGAGCTGCCAGGCGTTTCTTCTTGGCTGGTTAAGGTTTTCACTGACACCTTAGTCAA
GACAATGATTGAGCCTCGCCGTCGTTGTTTCAGCTTACCAGCAGTAGATTTAAGGAAAAAGGCTGTTGGTGGAATTGTAT
ACGTGTCAGTCATCTCAGCTAGCAAACTTTCTAGAAGTAACCTGAGAGGAAGTCCGCCAAGAAGGGTAAATGGTAGTTTC
ATAGAGCATTTTGATGATAAATATCTGCAAACATTTGTGGAGGTCGAGCTTGGACATTTGACAAGGAGAACAGATGTGAG
ACCAGGCTCAAACCCTAGATGGGATTCCACATTTAACATGTTCTTACATGAAGAAACTGGAACTCTTCGATTACATCTTT
ACAACCGCCCACCCAACAGTGTGAAGTATGATTATCTAGCAAGTTGTGAGATCAAGATGAAGTATGTTGCTGATGATTCA
ACAACGTTTTGGGCAATAGGACCCGACTCTGGTGTAATAGCCAAACATGCTGAGATTTGCGGAAAAGAGGTTGAAATGGT
TGTTCCATTTGAGGGAGTTACTTCAGGGGAGTTGACAGTAAAGCTTGTGGTGAAAGAATGGCTGTTCTCTGATGGTTCCC
ATAGCTTGAACAACGTTAGCTCTCAGAAGTCAATATATGGATCATCAAATATTCTTTCAAGAACAGGAAGGAAGATTAAC
GTGGCTGTCATGGAGGGAAAAGGTCTTATTTCAAAAGAAAGATCTGGAAAGTGTGACCCATATGTTAAACTGCAGTATGG
AAAGGTCCTACAGAAAACACGGACTGCACATAGCTCTAATCCTCTCTGGAATCAGAAGTTTGAATTTGATGAGATAGTAG
ATGATAGATGCCTTAAGATTAAATGCTACAGTGAAGAAATCTTTGGAGATGAGAGCATTGGTAGTGCACGAGTAAATTTG
GAAGGTTTGATGGAGGGATTTATCAGGGACATGTGGGTTCCCCTTGAAAAAGTGAATACAGGAGAATTAAGGCTTCAAAT
AGAAGCAGTACAAGTCAATGACTCTGAAGGATCACGGGGTTCTATGTCAGGTTCATTCAATGGTTGGATTGAACTTGTTC
TTGTTGAAGCGAAGGATCTTATTGCTGCTGATCTTAGGGGGACAAGTGATCCATATGTGAGGGTGCAATATGGAAGCTTG
AAGAAGAGAACAAAGGTTATGTACAAAACTCTGAATCCTCATTGGAATCAAACCCTCGAGTTTCCTGATGATGGCAGTCC
CTTAGAGTTGCATGTGAAAGACTATAATGCCTTGCTGCCCACCTATAGTATTGGTGATTGTGTTGTAGAGTATCAGGGAT
TGCCTCCAAACCAGATGTCCGACAAGTGGATTCCTCTCCAAGGAGTAACAAGGGGAGAGATCCATGTTCGGATAACTAGG
AAAGTTCCAGAACTACAAGCAAGAAACAGTTTGGAGTCTGACACATCTTTAATCAAATCACACCAAATCTCTAACCAGAT
GAAACAATTGATGATCAAGTTTCAATCTCTGATTGAGGAGGGCAGCCTAGAGGGGCTCTCGACAGCTTTGAGCGAGATGC
AAAGCCTAGAGGACATGCAAGAAGAGTACATGGTACAGATTGAGACTGAGCAAATGCTTCTACTTAACAAGATAAAGGAG
CTTGGTCAAGAAATTATGAGCTCATCGTCTTCCTTGAGCAGAAGATCTTCTGGACTTTGA