Details for Western poplar Locus Potri.012G055900

Position : Chr12 ( 5`- 5752301 .. 5753139 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G055900

Protein [Map View]
MSPTNHQAKTSNMYPPPPLKVNKDSHMIKKSSPPSSSSSSSSSSASSSLGIVGPVKPPQRHPVIIYTHSPKIIHTNPKDF
MSLVQKLTGLSRSEEDPAPQVKRENGGRREENKRKVKINDGNEGGLGDGQVQYSCFMQPLFQPPNLNYIPVFAPNSAGFL
CANQPFYNYTDPLYFPSPNRRNSIATKSTLEVKNEFCGY*

DNA
ATGAGCCCAACGAATCATCAAGCGAAGACCAGCAATATGTACCCTCCACCACCCTTGAAAGTCAACAAGGACTCTCACAT
GATCAAGAAATCTTCGCCGCCGTCGTCTTCGTCGTCGTCATCTTCATCCTCAGCATCTTCTTCGCTCGGCATTGTAGGTC
CTGTCAAACCCCCACAACGCCATCCAGTGATCATTTATACTCACTCGCCCAAAATCATCCACACAAATCCTAAAGATTTT
ATGTCACTGGTGCAGAAACTAACGGGTTTGTCGCGATCCGAGGAGGATCCCGCCCCTCAAGTAAAGCGAGAAAATGGTGG
TCGTAGGGAGGAAAATAAGAGGAAGGTGAAGATCAATGATGGTAATGAAGGAGGCTTAGGGGATGGACAAGTTCAATATT
CTTGTTTTATGCAACCTCTTTTCCAGCCACCAAATCTTAATTACATTCCAGTTTTTGCACCCAATTCAGCTGGATTTCTA
TGCGCAAACCAGCCATTTTATAACTACACCGATCCTTTGTATTTCCCTTCTCCAAATAGGAGGAATTCCATCGCCACAAA
GTCCACCTTGGAGGTGAAGAATGAGTTCTGCGGGTATTAA