Details for Western poplar Locus Potri.012G055800

Position : Chr12 ( 5`- 5744924 .. 5751795 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G055800

Protein [Map View]
MATPTVSKTRSMLEGLVREGSFKWLLGKRSSFNEELEEMERSPSAGRNWIAELSPLANLVVRRCSKILGVSASELQESYN
AEASDSLKHHSCYARNFLEYCCFRALALSTQVTGHLADKKFRRLTYDMMLAWETPAVASQPLLNVDEDFTVGLEAFSRIA
PAVPIIANVIISENLFEVLTVGTDGRLQFSIYEKYLSGLERAIKKMKTQSDSSLLSTVRLSRREKILEVDGTVTTQPVLE
HVGISTWPGRVTLTDHALYYEALRVVSYDKPKTYDLADDLKQIVNPELTGPWGTRLFDKAVLYKSISLSEPAVIEFPELK
GHTRRDYWLAVIREILFVHRFIKKFKISGVERDEALSLAVLGILRLQAIQEIISVNSVHCETLLMFNLCDQLPGGDLILE
TLANISSLRKLDRTNSDKTGGGMHSISARAMVSNLGFMLGTSSTDLNEAGLVVGETSVGEMSSLEKVVKESQNSFKKAVL
AQETVDGVKVDGIDTNLAVMKELLLPVMEVGTWLISLIHWDDPMKSLVFCLVLTYVIWRGWLGYAFGLMIIFLAIFMVLT
RFCNQGRPVEEIKVTAPPPMNTVEQLLAVQDAISQAEQYIQDGNIVLLKFRGLLLSIFPQASEKFAFTLLGVALILAFMP
SKYIILLTFLETFTRYSPPRTASTERWTRRLREWWFSIPAAPVVLEREKEDKKKK*

DNA
ATGGCTACACCTACTGTAAGCAAAACGAGAAGTATGCTTGAGGGTTTAGTAAGAGAAGGATCATTTAAATGGCTACTTGG
CAAGAGAAGTTCTTTTAATGAAGAACTCGAAGAGATGGAAAGATCTCCATCAGCTGGCAGGAATTGGATAGCTGAGCTCT
CCCCACTTGCTAATCTGGTTGTTCGTAGATGCTCAAAAATCCTTGGCGTTTCTGCAAGTGAACTTCAAGAAAGCTACAAT
GCAGAGGCTTCTGATTCATTAAAACATCATTCCTGTTATGCGAGGAACTTCTTGGAATACTGTTGCTTCAGAGCACTGGC
TTTATCTACTCAAGTAACCGGTCATCTAGCTGATAAAAAGTTCCGGCGGTTAACATATGACATGATGCTAGCTTGGGAGA
CTCCAGCAGTTGCTAGCCAACCATTGCTCAATGTAGATGAGGACTTCACAGTTGGTCTAGAGGCCTTCTCTCGAATAGCT
CCAGCAGTTCCAATCATTGCCAATGTGATTATCAGTGAAAATCTTTTTGAAGTGCTTACTGTGGGAACTGATGGTCGGCT
TCAATTCTCCATCTATGAAAAGTACCTTAGTGGACTAGAAAGGGCAATAAAAAAGATGAAGACCCAATCAGATTCATCAC
TCCTTTCTACAGTGCGATTGTCAAGAAGGGAGAAGATTCTGGAAGTAGATGGAACAGTGACGACCCAACCAGTTCTTGAA
CATGTTGGAATATCGACATGGCCAGGTCGGGTAACTCTCACAGATCATGCACTGTACTATGAAGCTCTCCGTGTTGTATC
CTATGACAAGCCGAAAACATATGATTTGGCAGATGACCTAAAACAGATTGTTAATCCTGAGTTGACTGGACCATGGGGTA
CTCGGCTTTTTGACAAGGCAGTCTTGTATAAATCTATTTCCTTATCAGAGCCAGCCGTGATAGAGTTTCCAGAGCTTAAA
GGCCATACTCGTCGTGATTACTGGTTGGCAGTTATCCGGGAAATTTTATTTGTTCACAGATTTATAAAAAAGTTCAAGAT
CTCTGGAGTTGAAAGGGATGAAGCACTTTCATTAGCTGTACTTGGAATTCTGCGACTTCAAGCAATTCAAGAAATTATTT
CTGTAAATTCTGTTCACTGTGAAACGCTTCTCATGTTTAATCTTTGTGATCAACTTCCTGGTGGCGATTTGATACTGGAA
ACCCTGGCAAACATATCATCCTTAAGAAAATTAGATCGAACTAACAGTGACAAGACTGGAGGTGGGATGCATTCAATCTC
TGCAAGGGCCATGGTTTCCAATTTAGGGTTCATGCTAGGAACAAGTTCAACTGATCTGAATGAGGCTGGGCTTGTTGTTG
GTGAGACATCTGTGGGAGAGATGAGTTCATTGGAGAAGGTGGTTAAGGAATCGCAAAACAGCTTCAAAAAAGCAGTGCTG
GCACAAGAAACAGTTGATGGAGTAAAAGTAGATGGCATTGACACCAATTTGGCAGTGATGAAGGAGTTACTTCTCCCTGT
TATGGAAGTTGGGACATGGCTTATTTCCTTGATACACTGGGATGACCCCATGAAGTCTTTGGTGTTCTGTTTGGTTCTTA
CTTATGTCATTTGGAGGGGATGGCTGGGCTATGCGTTTGGATTAATGATCATCTTTCTTGCTATCTTTATGGTGCTCACA
CGATTTTGTAACCAAGGAAGGCCTGTTGAAGAGATCAAGGTAACAGCACCTCCACCAATGAACACAGTGGAGCAGCTTTT
AGCTGTCCAGGATGCTATTTCTCAAGCTGAACAGTACATCCAAGATGGAAACATTGTCCTCCTCAAGTTTCGTGGCCTGC
TGTTGTCCATTTTCCCACAGGCAAGCGAGAAGTTTGCGTTCACTCTCCTGGGCGTTGCTTTGATCCTGGCTTTCATGCCT
AGCAAGTACATTATTCTGTTGACCTTCTTAGAGACATTTACAAGATATTCTCCTCCAAGGACAGCAAGCACAGAAAGATG
GACAAGGAGACTAAGAGAGTGGTGGTTCAGCATACCGGCGGCTCCTGTAGTTCTTGAAAGAGAAAAGGAGGACAAGAAGA
AGAAGTAA