Details for Western poplar Locus Potri.012G055300

Position : Chr12 ( 5`- 5613948 .. 5615550 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G055300

Protein [Map View]
MCSETSPRISFSNGLGHDREIEQVSRRDIKLLDSNSDFEFSICSSLGHESSPADELFADGMILPVQIPERITASKQIHKY
ESPRKDSLPPLPFPSTNGNLTKDSMRELMVVNSNQLKEKPQSKSFWGFKRSSSLNSDIKRSLCSLPLLSRSSSTGSVPYA
KRTTLKDMRKNNSQKQQSASSFVYSLPQKPPLKKAGSYGKISPVFNLPPPYIYKGTANLFGLGSFLRNGKEKKSRK*

DNA
ATGTGCTCGGAGACAAGCCCTCGAATATCATTCTCTAATGGTCTTGGACATGACAGAGAAATTGAGCAAGTGTCAAGAAG
GGACATAAAATTATTGGACTCAAATTCTGATTTTGAGTTCAGTATTTGCAGTAGTTTAGGCCATGAATCGTCTCCGGCAG
ACGAGCTTTTCGCAGATGGCATGATCCTGCCAGTTCAAATTCCAGAAAGAATTACTGCCTCAAAGCAAATACATAAATAT
GAATCTCCACGAAAAGATTCCCTTCCTCCTCTTCCATTTCCTTCTACTAATGGCAATTTAACTAAAGATAGCATGAGGGA
ATTGATGGTTGTGAATTCTAATCAGTTGAAGGAAAAGCCTCAGTCCAAGTCTTTCTGGGGATTCAAGAGAAGTAGTAGTC
TCAACAGTGATATCAAGAGAAGCCTTTGCTCATTACCACTTTTATCACGGAGCAGCTCAACTGGTTCTGTGCCATATGCA
AAGAGAACAACATTGAAGGATATGCGCAAGAACAATTCACAGAAGCAACAATCAGCTTCTAGTTTTGTTTATTCATTACC
ACAAAAGCCTCCATTGAAGAAGGCAGGGTCTTATGGTAAGATTAGTCCTGTGTTTAATTTGCCACCACCTTACATTTACA
AAGGAACTGCAAATCTTTTTGGTTTGGGATCCTTTTTGCGCAATGGAAAGGAGAAGAAGAGCAGAAAGTGA