Details for Western poplar Locus Potri.012G055200

Position : Chr12 ( 5`- 5604967 .. 5606561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G055200

Protein [Map View]
MASSSSQERSKQLHNFSLPCLRWGNQRLLRCVKVSDDIINSNDDNQHQQGFQSKPINLVSYKNYKPNPIQVNNAAAKRLK
LPSSSPFVVEEEKGGGNIDESPRPWNLRTRRAACKAPLRIEEQPSRRNVVVSPRGYLEIDSPKKYYESLMVKRQQSFEMK
EKVKFSVSLSKREIEEDFLEMVRIRPPRRPKKRPRIVQKNLDSIFPGLWLAEITPDSYKVQEVPES*

DNA
ATGGCTTCCTCATCATCTCAAGAGAGATCAAAGCAACTGCACAACTTTTCTTTGCCTTGTTTGAGATGGGGCAATCAGAG
ACTCCTTAGATGTGTCAAAGTCAGTGATGACATTATCAATAGCAATGATGATAATCAGCACCAGCAAGGATTTCAATCAA
AACCCATCAATTTGGTTTCTTACAAGAATTATAAACCAAACCCGATTCAAGTCAACAATGCTGCTGCCAAAAGATTGAAG
CTTCCTTCTTCTTCTCCTTTTGTTGTTGAGGAAGAGAAAGGAGGAGGAAATATTGATGAATCTCCAAGACCCTGGAATTT
GAGGACTAGAAGGGCAGCTTGTAAGGCTCCACTTAGAATCGAAGAGCAGCCGTCAAGGAGAAATGTTGTTGTTTCTCCAA
GGGGGTATTTAGAGATTGATTCACCAAAGAAATATTATGAGAGTTTGATGGTGAAGAGGCAGCAGAGTTTCGAGATGAAG
GAGAAAGTCAAGTTTTCGGTTTCTTTATCAAAGAGAGAGATTGAAGAGGATTTTCTTGAGATGGTTAGAATTAGGCCACC
AAGGAGGCCTAAGAAGAGGCCTCGAATCGTACAGAAGAATTTGGATTCAATTTTCCCTGGGTTGTGGCTAGCTGAAATTA
CACCAGATTCATACAAGGTTCAAGAAGTGCCTGAATCATGA