Details for Western poplar Locus Potri.012G054300

Position : Chr12 ( 5`- 5504366 .. 5505126 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G054300

Protein [Map View]
MRTSCMVVCTLLVLLLAKEHAKVDAVTCSPAQLSSCVSAITSSTPPTNLCCSKIKEQKPCLCQYLKNPKLQKFINTPNAR
KVASTCGTPFPKC*

DNA
ATGAGGACATCTTGTATGGTAGTTTGCACTCTTTTGGTACTACTTCTGGCTAAAGAACATGCCAAAGTGGATGCTGTGAC
ATGCAGCCCAGCACAGCTGAGCTCTTGTGTGAGTGCAATCACATCTTCTACTCCACCAACTAACCTATGCTGCAGCAAGA
TCAAGGAACAGAAGCCTTGCCTTTGCCAGTACCTCAAGAACCCAAAACTTCAGAAGTTTATCAACACTCCAAATGCCAGG
AAAGTTGCTAGCACCTGTGGAACTCCCTTCCCCAAATGCTAA