Details for Western poplar Locus Potri.012G054200

Position : Chr12 ( 5`- 5478185 .. 5484035 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G054200

Protein [Map View]
MLSIGSLCLSLGTTPKPLKPSKTPKPIRKLYATKAMAGSNPKQVSTFEFRDLMETFAVDVKRAENRPLNVPLIAPFTIAS
SRLDKVENVAIRIELSDGCVGWGEAPILPFVTAEDQSTAMIKAREACELLKNSSSMKLGLVLERVSEILPGHEFASVRAG
VEMALIDAVAKSINVPLWILFGGASDSITTDITIPIVSSAEAAELASKYRKQGFQTLKLKVGKNLKEDIEVLQAIRAVHP
DCLFILDANEGYKPEEAIEVLEELHKMGVTPILFEQPVHRDDWEGLGHVTHIAKGKYGVSVAADESCRSLVDAKRIIKGN
LADVINIKLAKVGVVGGLEIIEEARTSGLDLMIGGMVETRLAMGFAGHLAAGFGCFKFIDLDTPLLLSEDPVLEGYEVSG
AVYKFTDAQGHAGFLDWDNVLW*

DNA
ATGCTTTCAATTGGGTCTCTCTGTCTCTCTCTCGGAACTACTCCAAAACCTCTAAAACCCTCTAAAACCCCTAAACCCAT
TCGCAAGCTTTATGCAACTAAAGCAATGGCTGGATCAAACCCCAAACAAGTTTCAACCTTTGAGTTTAGGGATTTGATGG
AGACTTTTGCGGTGGATGTTAAGAGGGCAGAAAATAGGCCATTGAATGTGCCATTGATTGCACCTTTTACAATAGCTTCA
TCAAGGCTTGACAAAGTGGAGAACGTGGCAATTAGGATTGAATTGAGTGATGGTTGTGTGGGGTGGGGTGAGGCACCGAT
ATTGCCATTTGTTACTGCAGAGGATCAGTCCACTGCTATGATTAAGGCTAGAGAGGCTTGTGAGTTGCTGAAGAACAGTT
CATCGATGAAGTTGGGCTTGGTTTTGGAGAGAGTTTCTGAGATTCTTCCCGGACATGAGTTTGCTTCTGTTAGAGCAGGA
GTCGAGATGGCATTGATTGATGCAGTGGCTAAAAGCATCAATGTACCTTTATGGATATTATTTGGTGGAGCTTCTGATAG
CATAACAACTGATATAACAATTCCAATTGTATCTTCTGCAGAAGCTGCTGAATTGGCTTCAAAGTATCGGAAACAAGGAT
TCCAAACTTTAAAGTTGAAGGTGGGAAAGAACCTTAAGGAGGACATAGAAGTTCTTCAAGCTATACGTGCGGTCCATCCT
GATTGCTTATTTATCTTGGATGCTAATGAGGGTTATAAACCAGAGGAAGCTATTGAAGTTCTTGAAGAATTGCACAAAAT
GGGGGTAACTCCCATTCTTTTTGAACAACCAGTTCATAGAGATGATTGGGAAGGTCTTGGTCATGTTACTCATATCGCAA
AAGGCAAATATGGGGTATCTGTTGCAGCAGATGAGAGTTGTCGTAGCTTAGTTGATGCAAAGAGAATAATAAAAGGAAAT
CTTGCAGATGTCATTAACATTAAGCTTGCTAAAGTTGGTGTTGTTGGGGGACTTGAAATTATTGAGGAGGCAAGGACATC
AGGATTGGATCTGATGATTGGTGGAATGGTTGAGACCAGACTAGCCATGGGCTTTGCTGGTCATCTTGCTGCTGGCTTTG
GCTGTTTCAAGTTCATTGATTTGGACACACCCCTTTTACTGTCAGAAGATCCTGTCCTTGAGGGTTATGAAGTATCGGGT
GCTGTTTACAAATTCACAGATGCTCAAGGGCATGCTGGTTTCCTTGACTGGGACAATGTTTTGTGGTAA