Details for Western poplar Locus Potri.012G054100

Position : Chr12 ( 5`- 5474043 .. 5475619 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G054100

Protein [Map View]
MPIYSSDSDNETTPRTKLFGRQRPIRSVLGGGQVAGVLLWENKKVSAALSFGMTILWFLFEVAEYNFVTLFSHISITAML
IVFIWCTSAEFFNWNPPAIPRSILDKSTFHEFALTFHERFNQALSSFVDIACGKQPALFFVAIFCLYILSVIGNYFTFLN
FLYLCFVCLQTLPFLYNKYEDEVERYAGKLTREVKKMYRRFDSNVLNKIPRGVPVKEKKGR*

DNA
ATGCCGATTTATTCTTCGGATTCGGACAATGAAACAACGCCACGGACAAAGCTTTTCGGGCGGCAGAGACCAATACGATC
TGTTCTAGGAGGAGGACAAGTTGCTGGTGTGTTACTATGGGAAAACAAAAAAGTGTCAGCAGCACTTTCTTTCGGAATGA
CAATATTATGGTTTCTCTTTGAGGTTGCTGAGTACAATTTTGTGACTCTCTTCAGTCACATCTCCATCACAGCAATGCTC
ATTGTCTTCATATGGTGCACCAGCGCAGAATTTTTCAATTGGAATCCTCCCGCGATCCCAAGAAGTATTTTAGACAAATC
TACATTCCATGAATTTGCTCTCACCTTCCATGAAAGATTCAATCAGGCCTTGTCAAGTTTCGTTGACATTGCATGTGGAA
AACAACCAGCACTCTTCTTCGTGGCAATATTTTGTCTCTACATATTATCTGTGATTGGAAACTATTTCACGTTCTTGAAT
TTCCTTTATCTATGTTTTGTTTGCTTGCAAACTCTGCCATTTCTCTATAATAAATACGAGGATGAGGTGGAGAGGTACGC
TGGTAAATTGACCCGAGAAGTCAAGAAAATGTACAGAAGGTTTGATTCCAATGTTCTTAACAAGATACCAAGAGGAGTAC
CGGTGAAGGAGAAGAAAGGCAGATGA