Details for Western poplar Locus Potri.012G053500

Position : Chr12 ( 5`- 5408743 .. 5411011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G053500

Protein [Map View]
MDPPPLPPLHNATTSANPTTVHLNYPDSVESSPRSHPPDSTFNETLPPVPGAKLRLMCSYGGHIIPRPHDKTLCYVGGET
RMVAIDRHSSLPILSSRLSRTLLNGRPFTLKYQLPHEDLDSLVSVTTDEDLDNMIEEYDRINASSSALSPSRIRLFIFFS
KPETAASMGSLLDDAKSETWFVDALNGSGLIPRNLSDSATLECLVTLDNDQDLEAQAEGVEGENKKAKNELLHEVHTTLS
DSPVVEKNSSFGSSSSSPSMTNLPPIRVRVEDPRVGVEEQFAQMTYAQVVQKHDDGYGLLSAPPPPIPVSISAVGTAIST
NPAGGSSEHLNRLLSDDERSDQGVPVSFRKPPLPVLQPVPHKTGTCYNLPSPDSVASDSSIASASSLSKPMYYQDQAHAA
PRDNRGPSSPDTKGDIPIPSSQIQMQQVQGSGYTLPDQQQQQQQFVGGSTHFTTTPMPMTSYYPIYAPPSQQPHLPMDHQ
YPVYLMQVTQPQPYMSMQTNMVDTATVATTSRPATPSTATYRDPHPPIYPAKTVSTSAKPEMAATVYRTVMPSTPPLVHV
PANQFQQSYMGYSQMQHPTQSINAAATNYAYSEYANSTHDQFYYTPSTQGSPQYQSMNPATVVALADDSTRIPTNNTMQQ
NIGTSQPQ*

DNA
ATGGATCCACCACCTCTGCCACCTCTCCACAATGCTACCACCTCTGCCAATCCCACCACTGTCCATCTGAACTACCCTGA
CTCTGTTGAGTCCTCGCCCCGCTCCCATCCACCAGACAGTACATTCAATGAGACTCTCCCGCCTGTCCCAGGTGCTAAGC
TCCGCCTAATGTGCAGCTATGGAGGCCACATAATCCCCCGTCCACATGACAAAACCCTCTGCTATGTAGGCGGTGAGACA
CGTATGGTAGCCATTGACCGGCATTCCTCTCTCCCCATCCTCTCCTCCCGCCTTTCTCGAACTCTCCTCAATGGTCGTCC
CTTCACTCTCAAGTACCAGCTGCCTCATGAAGACCTTGACTCTCTAGTATCTGTAACCACAGATGAAGATCTTGACAACA
TGATAGAAGAATATGACCGCATAAATGCATCATCATCAGCTTTATCTCCTTCCCGTATCCGCTTGTTCATTTTCTTTAGC
AAGCCTGAGACTGCAGCCTCCATGGGATCACTTCTTGATGATGCAAAGTCAGAAACATGGTTTGTTGATGCGCTTAATGG
TTCAGGATTAATTCCACGAAACCTATCAGATTCTGCTACATTGGAATGCTTAGTGACTCTTGACAATGATCAGGACTTGG
AGGCTCAGGCAGAAGGTGTTGAAGGGGAGAACAAGAAAGCTAAGAATGAACTATTGCACGAAGTGCACACCACACTATCT
GACTCACCTGTTGTGGAGAAGAATTCATCATTTGGTTCATCTTCTTCTTCCCCTTCAATGACCAACCTGCCACCTATCCG
GGTTCGTGTGGAGGATCCAAGAGTTGGAGTTGAGGAGCAGTTTGCACAGATGACTTATGCTCAAGTTGTGCAGAAGCATG
ATGATGGCTATGGCCTTTTATCTGCTCCGCCACCTCCAATTCCTGTATCAATATCTGCAGTTGGAACTGCAATATCCACT
AATCCTGCTGGTGGGTCTAGTGAGCACTTGAATCGGCTTTTATCAGATGATGAGAGGTCGGATCAGGGTGTTCCGGTAAG
TTTTCGCAAACCACCACTTCCTGTACTGCAGCCCGTGCCACACAAGACCGGTACCTGTTACAACTTGCCTTCACCAGATT
CAGTTGCAAGTGATAGTAGTATTGCGTCTGCAAGCTCTCTTTCAAAGCCCATGTATTATCAAGATCAAGCTCATGCAGCA
CCCAGAGACAACAGAGGTCCTTCTAGCCCTGATACAAAAGGTGATATTCCAATCCCAAGCTCTCAAATCCAAATGCAACA
AGTCCAAGGTTCTGGATACACGTTGCCTGATCAGCAGCAGCAGCAGCAACAATTTGTAGGAGGCAGCACACATTTCACCA
CAACTCCAATGCCAATGACATCTTACTACCCAATTTACGCTCCTCCGTCACAACAGCCTCATCTTCCAATGGATCACCAA
TATCCTGTATACTTAATGCAGGTTACTCAACCACAACCATACATGTCTATGCAAACTAACATGGTTGACACTGCTACTGT
TGCAACCACGAGCCGCCCTGCAACACCTTCCACTGCAACTTACAGGGACCCACATCCACCCATTTACCCTGCAAAGACAG
TATCTACCTCAGCTAAGCCTGAAATGGCTGCAACTGTGTACAGAACAGTGATGCCATCAACTCCTCCATTAGTCCATGTC
CCGGCCAATCAGTTCCAGCAATCATACATGGGTTATTCTCAAATGCAACATCCAACTCAATCCATTAATGCTGCTGCTAC
TAATTATGCTTATTCTGAATATGCAAATTCTACACATGACCAATTCTACTACACCCCTAGTACTCAAGGTTCTCCTCAGT
ACCAATCCATGAACCCAGCTACAGTCGTAGCATTAGCAGATGATTCAACACGGATACCAACAAACAACACAATGCAGCAG
AACATCGGAACCTCGCAGCCACAATAA