Details for Western poplar Locus Potri.012G049700

Position : Chr12 ( 5`- 4711136 .. 4719877 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G049700

Protein [Map View]
MLSLRNFWRRHRSKILITAGVLGSGYFLYRLYNAHEQRLADLERELARQRANDELIKAQLQAHFENVQLIADTTTLPHAM
QYLRSRIAEELDLSQLTERLQKGKGKPYTLTSSEKLELWDRLKILSFTQMVVSLWAVTILSLYIKVQVNILGRHLYIDTA
RGLGSSLLLENVDLIDRDDQQNFLAGADFLANNGLLALISNIQAVVTEVIEGKKLIDLFNTTSFHETVMQILDKFMSVGS
LHQWIDYLMPEDSGHYKLGTSSSIDDTVLPNSTNFDQLMVEARTVLSSAEFGKIMGISLKVAVDALVEDMEAQCQSTGAS
LTSGMPLAKLLSRVMQMVPSLLREASQNQFIKIIRTVPEVELFFTLLYANNLVD*

DNA
ATGCTTTCTTTAAGGAATTTTTGGAGAAGGCATAGGAGTAAAATTCTTATTACAGCAGGTGTTTTAGGAAGTGGGTATTT
TCTTTATAGACTATACAATGCTCACGAACAGAGGCTCGCTGATCTGGAAAGAGAACTTGCTCGCCAACGGGCAAATGATG
AACTCATCAAGGCCCAATTGCAAGCCCATTTCGAGAATGTGCAATTAATAGCTGATACAACAACATTGCCTCATGCAATG
CAATATTTAAGAAGTAGGATAGCGGAAGAGTTGGACCTTTCACAGCTCACTGAAAGGCTACAGAAAGGGAAGGGTAAGCC
ATACACGCTTACCTCTTCAGAGAAACTTGAACTGTGGGACAGACTCAAAATCCTAAGTTTCACACAAATGGTGGTGTCGC
TGTGGGCTGTGACAATACTTAGCTTATATATCAAAGTTCAAGTAAATATTCTAGGAAGACATTTGTATATTGATACTGCA
CGTGGCCTTGGAAGCTCACTTTTACTTGAGAATGTTGATCTCATTGACAGGGATGACCAGCAAAATTTTTTGGCGGGTGC
TGATTTTCTTGCTAATAATGGCCTGCTGGCATTGATTTCAAATATCCAGGCTGTGGTAACAGAAGTTATTGAGGGAAAGA
AGTTGATTGATTTGTTCAACACCACATCTTTTCACGAAACTGTCATGCAAATACTTGACAAGTTTATGAGCGTGGGAAGT
CTACATCAATGGATAGATTACTTAATGCCTGAAGATAGTGGGCACTACAAACTAGGCACAAGCTCCAGCATTGACGACAC
GGTCCTTCCTAATAGCACAAATTTTGATCAGCTTATGGTGGAGGCACGAACAGTGCTATCAAGTGCTGAATTTGGTAAAA
TCATGGGAATATCTTTGAAAGTGGCAGTGGATGCACTGGTGGAGGATATGGAAGCTCAGTGTCAGTCCACTGGGGCCAGT
CTAACATCGGGGATGCCACTGGCAAAACTTCTATCACGAGTTATGCAGATGGTACCATCGTTACTCCGTGAAGCAAGCCA
AAACCAGTTTATCAAAATCATCCGGACTGTACCAGAAGTTGAACTGTTCTTCACTCTCCTCTATGCAAACAACCTTGTAG
ACTAG