Details for Western poplar Locus Potri.012G049600

Position : Chr12 ( 5`- 4700051 .. 4702102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G049600

Protein [Map View]
MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSASRDKSIILWHLTKDEKTYGVARRRLTGHSHFVQDVVLSSDGQFAL
SGSWDGELRLWDLATGVSARRFVGHTKDVLSVAFSFDNRQIVSASRDKTIKLWNTLGECKYTIQEAESHTDWVSCVRFSP
STLQPTIVSASWDKTVKVWNLTNCKLRSTLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGAVINA
LCFSPNRYWLCAATENSIKIWDLESKMVVDDLKVDLKAEAEKSEGTTATAVSTKKKIYCTSLNWSADGSTLFSGYTDGVI
RVWGVGRY*

DNA
ATGGCCACCGAGACCCTTATTCTTCGAGGCACCATGAGAGCCCACACTGACCAGGTCACAGCAATAGCCACACCAATTGA
CAACACTGACATGATTGTCAGTGCATCCCGCGACAAGTCCATCATTCTTTGGCACTTAACCAAAGATGAAAAAACCTATG
GTGTCGCTCGCCGTCGTTTGACTGGTCACTCCCACTTCGTACAAGACGTTGTTCTCTCCTCCGATGGTCAGTTCGCTTTG
TCCGGTTCCTGGGACGGCGAGCTCCGCCTCTGGGACTTGGCTACTGGTGTCTCTGCTCGCCGATTCGTCGGCCACACCAA
GGATGTGTTGTCTGTTGCCTTCTCTTTTGATAACCGACAGATCGTTTCTGCTTCAAGGGATAAGACAATCAAGCTGTGGA
ATACTCTTGGTGAATGCAAGTATACCATTCAAGAGGCTGAATCTCATACCGACTGGGTTTCGTGTGTGCGTTTTAGCCCA
AGTACGTTGCAGCCCACGATTGTTTCTGCTTCATGGGACAAGACAGTGAAGGTTTGGAATTTGACTAACTGCAAGCTGAG
GTCTACACTTGCAGGGCATAGTGGATATGTGAACACGGTGGCTGTTTCGCCAGATGGGTCATTGTGTGCAAGTGGAGGGA
AAGATGGGGTGATTTTGTTGTGGGATTTGGCTGAAGGAAAGAAGCTTTATAGTTTGGATGCAGGTGCAGTGATTAATGCG
TTGTGCTTTAGCCCTAATAGGTACTGGTTATGTGCTGCCACAGAGAATAGCATTAAGATTTGGGATCTGGAGAGCAAGAT
GGTTGTTGATGATTTGAAGGTTGATCTAAAAGCCGAAGCTGAGAAATCCGAGGGTACTACCGCAACTGCTGTCAGTACCA
AGAAGAAGATCTACTGCACAAGCTTGAACTGGAGTGCTGATGGAAGCACCTTGTTCAGTGGCTATACCGATGGTGTTATC
CGAGTCTGGGGAGTTGGTCGCTATTAG