Details for Western poplar Locus Potri.012G049300

Position : Chr12 ( 5`- 4667840 .. 4672376 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G049300

Protein [Map View]
MRAKALPFLIFCLSIVQCISHAAESNGASEKPETVSFETAGGLRHSFPKGFVFGTATSAYQVEGMAEKDGRGPSIWDEFV
KIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGTGKVNWLGVAYYNRLINYMIEKGITPYANL
YHYDLPLALEKKYKGLLSYQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSA
TEPYIVAHHLILSHAAAVQRYREKYQVSICSSVFELDAIHIFNGEECYIPYSFSFYIAGKTKGKDWDSLGFCLLRTFTSS
KADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVGNRLPQFTKEEVKMVKGSMDFVGINQYTTFYMYDPHQPKPKYLGY
QQDWNVGFAYKKNGVPIGPRANSNWLYNVPWGMYKAVMYIKERYGNPTIILSENGMDDPGNFTRSKALHDTTRVGYFKAY
LTQLKKAADEGANLAGYFAWSLLDNFEWRSGYTSRFGIVYVDYTNLKRYPKMSAYWFKKLLERNKH*

DNA
ATGAGAGCTAAGGCATTGCCATTCTTGATATTCTGTCTCAGTATTGTTCAGTGTATCTCCCATGCAGCAGAATCCAATGG
AGCCTCGGAGAAGCCTGAGACCGTTAGTTTTGAAACAGCAGGAGGGCTGAGACACAGCTTCCCTAAGGGGTTTGTCTTTG
GAACTGCTACTTCTGCTTATCAAGTTGAAGGCATGGCTGAGAAGGATGGTCGCGGGCCTAGCATTTGGGATGAATTTGTT
AAAATTCCTGGGATCGTTGCCAATAATGCCACAGGGGAAGTGGCAGTGGACCAGTATCACCACTACAAGGAAGATGTAGA
TATCATGAAAATGTTGAACTTCGATGCATACCGGTTCTCGATTTCATGGTCCAGAATTTTCCCTGATGGAACTGGAAAAG
TGAATTGGTTGGGAGTTGCATACTACAATAGGTTGATCAACTACATGATCGAAAAAGGCATTACTCCATATGCGAATCTT
TATCACTATGATCTTCCCCTAGCACTAGAGAAGAAGTATAAAGGATTGCTGAGTTACCAAGTAGTGAAAGACTTTGCCGA
TTATGCAGACTTCTGTTTCAAGACCTTTGGAGACCGAGTGAAGAATTGGATGACATTCAATGAACCCAGAGTGGTAGCTG
CACTTGGATATGATAATGGATTATTTGCTCCTGGCAGGTGTTCCAAAGCATTCGGGAACTGTACAGCCGGCGACTCTGCA
ACAGAGCCTTATATTGTTGCTCATCATTTGATTTTATCTCATGCAGCCGCAGTTCAGAGATACCGCGAGAAGTATCAAGT
TAGCATCTGTTCTTCTGTTTTTGAACTGGATGCAATTCATATATTCAATGGAGAAGAATGTTATATACCTTATTCTTTTT
CATTCTACATTGCAGGAAAAACAAAAGGGAAGGATTGGGATTCTCTTGGATTTTGTTTATTACGAACCTTTACCAGCTCA
AAAGCTGACAACTTGGCAGCTCAAAGAGCAAGAGACTTTCACATTGGATGGTTTATCCATCCTATTGTGTATGGTGAATA
TCCAAAAACAATGCAAAATATTGTCGGGAATAGACTACCCCAGTTTACAAAAGAAGAAGTTAAGATGGTGAAGGGCTCAA
TGGATTTTGTGGGCATCAACCAATATACAACTTTCTACATGTATGATCCTCATCAGCCTAAACCAAAGTACTTGGGCTAC
CAGCAAGATTGGAATGTTGGATTTGCTTATAAGAAGAATGGAGTGCCAATTGGTCCAAGAGCAAATTCTAATTGGCTTTA
CAATGTACCATGGGGTATGTACAAGGCTGTGATGTACATAAAAGAGCGCTATGGAAACCCTACAATTATACTATCTGAAA
ATGGGATGGATGATCCTGGTAATTTCACGCGTTCGAAAGCATTGCACGACACCACTAGAGTTGGCTACTTTAAGGCCTAT
TTGACTCAGCTGAAGAAGGCAGCTGATGAAGGAGCCAATTTAGCTGGTTACTTTGCATGGTCATTGCTTGACAACTTTGA
ATGGAGGTCAGGCTACACTTCAAGGTTCGGCATAGTATATGTTGATTACACCAACCTAAAGAGGTACCCCAAAATGTCTG
CCTATTGGTTCAAGAAACTACTGGAGCGGAACAAACACTAA