Details for Western poplar Locus Potri.012G049000

Position : Chr12 ( 5`- 4621139 .. 4624052 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G049000

Protein [Map View]
MSLNILTFLLLLTCFPLLLAGMPNPDPATIQPFKPGPTPPATIPASPEQSNLAGCPLELPNELFNGIKSACGSGSSASGH
LHRTRCCPVLAAWLYSAYSATALSRANKVIPATTTGRSPSYDMPLLPDDSETCVDGLSKGLKEKGIELVKPNETCDVVYC
YCGIRLHPLSCPEAFSLNRKGKLVGDKRVKKLERNCLSNSNNVNGFPGLGGCSKCLNSLHLLNNKKTLNSSKSDDRTARM
HSKDCQLMGLTWLLAKNRTAYIHTVTAVIRAMMLSTDGFDPQSCTLNSDGMPLAVDSSEISNNSLSICHQVPIYAAMAFI
CLLNLLLIVPSTKF*

DNA
ATGTCCCTAAACATTCTAACTTTCCTCTTGTTACTCACTTGTTTTCCTCTTCTCCTTGCGGGTATGCCCAACCCGGACCC
GGCTACAATTCAACCATTTAAACCAGGCCCAACACCGCCAGCAACAATCCCTGCATCCCCTGAGCAATCTAACCTTGCTG
GTTGCCCATTAGAGCTTCCCAATGAACTCTTCAATGGCATTAAATCAGCTTGTGGTAGTGGCTCCTCTGCTAGCGGGCAC
CTCCACAGGACCCGGTGCTGTCCAGTTCTTGCTGCTTGGCTTTACTCTGCTTACTCTGCCACTGCACTTAGCAGAGCTAA
CAAAGTAATCCCAGCAACAACAACGGGTCGTTCTCCATCGTATGACATGCCCTTGCTTCCTGATGACTCCGAGACTTGTG
TTGATGGGCTCTCCAAAGGGTTGAAAGAGAAAGGCATAGAATTGGTTAAGCCTAATGAGACTTGTGATGTTGTGTATTGT
TATTGTGGTATTAGATTGCACCCTCTGAGTTGCCCGGAAGCCTTTTCTTTGAACCGAAAGGGAAAGCTTGTTGGGGATAA
GAGAGTTAAGAAATTAGAAAGAAATTGCTTGAGTAATAGTAACAATGTGAATGGATTTCCTGGTCTTGGTGGCTGCTCCA
AGTGCTTGAACAGTCTTCACTTGCTTAACAACAAGAAGACTTTAAATTCAAGCAAATCAGACGATAGGACCGCAAGAATG
CACAGCAAAGATTGCCAGTTGATGGGTCTTACATGGCTACTTGCCAAGAATCGCACGGCTTACATTCACACAGTTACTGC
AGTCATACGAGCTATGATGCTGAGCACCGACGGCTTTGATCCACAGTCGTGCACTCTCAACAGTGACGGAATGCCTCTAG
CCGTAGATTCTTCTGAAATCTCCAACAATTCTTTGTCAATCTGTCATCAAGTTCCCATCTATGCAGCCATGGCTTTCATT
TGTTTGTTAAATCTTCTACTCATTGTACCATCCACCAAATTTTAG