Details for Western poplar Locus Potri.012G048500

Position : Chr12 ( 5`- 4534574 .. 4539010 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G048500

Protein [Map View]
MDPPPPSLLIPPPVPPSIPPPPSTTETPTTTETPHLAPPPNPTPTITHPSYAEMIYSAITALKEQDGSSRIAIAKYIERA
YPGLSPSHSDLLTHHLKRLKNSGALVLNKKSYLLPRSDINTDISATITTTATVSTNPPQIQPQYVAPISSAPPEQKRGRG
RPPKTKANGLPPTPASVLANGQPQTGLGSHVSVTAQTQSQLVVSSVGTPVDSTSTGRKGRGRPKKMVVTEAGPLVVKKGR
GRPPNSGPLGSKKSPGRPRKPKSLVGAKKGPGRPPKNQLKPVTVPYAVASPTATDAAAVFNVASPKPRGRPRKGAAPTNA
GAVVMVQAKPPGRPAKVPGVMKLKPKKNSGRPVGRPRKNANAPWAINRASQLQAQAELHGDLKRKLEFFQSRIKQAAGVL
KPLLTSATISAVAAIQELEGLASMDINVPWREEPQPQTQPQPQPLPLPLPQPQLLPQPQPLQQLLKS*

DNA
ATGGACCCACCTCCTCCTTCATTATTGATCCCTCCACCAGTTCCGCCGTCCATCCCTCCACCACCATCCACCACCGAAAC
CCCCACCACCACTGAAACCCCCCATTTAGCTCCTCCACCCAACCCTACCCCCACCATAACCCATCCTTCCTATGCTGAGA
TGATATATTCAGCGATTACAGCTTTGAAAGAACAAGATGGGTCAAGCAGGATAGCCATAGCAAAGTATATAGAGAGAGCT
TACCCTGGTTTATCACCGAGTCACTCTGATTTGTTGACACATCACTTAAAACGCTTGAAAAATAGTGGGGCTCTTGTTCT
CAACAAGAAATCTTACTTGTTACCCAGATCTGACATTAACACAGACATCAGTGCTACTATAACTACCACAGCTACTGTTT
CTACTAACCCACCTCAAATTCAGCCACAGTATGTTGCTCCTATCTCTTCAGCTCCTCCTGAGCAGAAAAGGGGCCGTGGA
AGGCCCCCTAAAACTAAGGCTAATGGGCTTCCTCCAACTCCTGCGTCTGTGCTTGCTAATGGGCAGCCACAGACTGGTCT
TGGCTCACATGTTTCTGTTACTGCCCAGACTCAAAGTCAGCTTGTTGTGAGTTCTGTTGGGACTCCTGTTGACTCCACCT
CGACAGGGAGGAAAGGCCGAGGACGGCCAAAGAAGATGGTGGTGACTGAAGCTGGGCCGTTGGTGGTGAAGAAAGGAAGA
GGGAGGCCACCGAATAGCGGGCCGTTGGGGTCCAAGAAGAGTCCAGGAAGGCCCAGAAAGCCTAAGTCTTTGGTGGGTGC
TAAAAAGGGTCCTGGACGTCCACCTAAGAATCAGTTAAAGCCAGTTACTGTTCCTTACGCTGTTGCTTCTCCTACTGCTA
CTGATGCAGCAGCTGTGTTTAATGTGGCATCACCAAAGCCCAGAGGCAGGCCAAGGAAGGGTGCAGCCCCAACTAATGCT
GGCGCTGTTGTGATGGTGCAGGCTAAGCCACCGGGTCGCCCGGCTAAGGTTCCTGGGGTTATGAAGCTGAAGCCTAAGAA
GAATTCTGGCAGGCCTGTCGGCCGGCCTAGGAAGAATGCAAATGCACCATGGGCAATTAACAGGGCATCTCAGCTTCAAG
CACAAGCAGAATTGCATGGAGATCTTAAGAGGAAACTTGAATTTTTTCAATCAAGAATTAAGCAAGCCGCTGGGGTCCTA
AAGCCTCTTTTGACCAGTGCCACAATCAGTGCAGTTGCAGCAATCCAAGAATTAGAAGGGCTTGCATCAATGGACATTAA
TGTACCATGGAGAGAGGAACCTCAACCACAAACTCAGCCACAGCCACAGCCGCTGCCCCTGCCCCTGCCCCAGCCGCAGC
TGCTGCCCCAGCCCCAGCCGCTGCAGCAACTGCTCAAGAGTTAG