Details for Western poplar Locus Potri.012G047300

Position : Chr12 ( 5`- 4417256 .. 4418186 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G047300

Protein [Map View]
MQQKGRACNRRSRSFSRSRIAVEENPLPFLHYLSALFNKVPFNKAAHVEEREIQKKYWMDNISDLSVNAMMLDSKASELD
KEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVKSPDLNFSEG
SVDLIFSNWLLMYLSDKEVNR

DNA
ATGCAGCAGAAAGGCAGGGCTTGTAACCGTAGATCCAGGAGCTTTTCAAGATCTCGCATTGCCGTTGAGGAGAACCCCCT
TCCTTTTCTTCATTATCTCTCTGCCTTGTTCAACAAAGTTCCTTTCAACAAGGCTGCTCATGTGGAAGAACGCGAGATTC
AAAAGAAATATTGGATGGATAACATTTCTGATTTGAGTGTGAATGCGATGATGCTTGACTCCAAAGCATCTGAACTTGAC
AAGGAAGAAAGACCTGAGATACTTTCTCTGCTTCCACCCTATGAAGGAAAAACAGTTTTGGAACTTGGAGCTGGTATTGG
CCGCTTCACTGGGGAATTGGCACAGAAGGCCAGCCAAGTTGTGGCTCTGGACTTCATTGAGAGTGCCATAAAAAAGAATG
AAAATATTAATGGACACTATAAGAATGTCAAGTTTATGTGCGCTGATGTGAAATCCCCAGATCTGAATTTTTCAGAGGGA
TCGGTGGATTTGATATTCTCAAATTGGCTTCTCATGTATCTTTCCGACAAGGAGGTGAACAGA