Details for Western poplar Locus Potri.012G046900

Position : Chr12 ( 5`- 4305995 .. 4314815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G046900

Protein [Map View]
MASNSANLWVLLGLGLAGILLMTKKFKKSIIRQDFGAFIEKLLLVPPPQPPPPKAPHPLTALTFAVSDLFEIEGYVSGFG
HPEWAKTHQAASRTSLVVSTLVDGGATCVGKTVIDELAYSIHGENKHYGTPINPVVPARVPGGSCSGAAVAVAANLVDFS
LGVDTVGGVRVPAGFCGVIGFRPSYGAISKTGVLPVSASLDTVGWFAKDPNILRRVGHVLLQPAFGGQRSPRQIIMAEDC
FQLLKIPVDRVAQVVVNSTEKHFGRQVLKHEILDVYLNSKVPSLKEFHNKKKNGDVKTSSIRLLAHVMQLLHRYEFRSNH
EEWINTEKPILEPDFSAQMNEIMKISEAEIELCKSIREEMRLAINSLLKDDGILVVPTMAYLPPKLDGKEILSEEYKSSS
FSLLSIASLSGCCQVTVPLGYYDKCPVSVSLIARHGNDRFLLDTLQTMYASLQEQAETHVKSKSRNTDSGENSAEMAKEK
GNQAFKEKQWKKAISYYNEAIKLNDKNATYYSNRAAAYLELGSFHQAEADCSKAINLDKKNVKAYLRRGTAREMLGYYKD
AIEDFKYALVLEPTNKRASLSAERLRKVFPVGY*

DNA
ATGGCGTCGAATTCTGCAAATCTATGGGTGTTATTAGGATTAGGACTGGCTGGGATTTTGTTAATGACTAAAAAGTTTAA
GAAATCTATTATTAGACAAGATTTTGGCGCTTTTATCGAGAAGCTTCTGCTAGTTCCTCCGCCGCAGCCCCCTCCTCCTA
AAGCTCCTCACCCTCTCACCGCCCTCACCTTCGCCGTCTCCGACTTATTTGAGATAGAAGGATATGTGAGTGGATTCGGT
CATCCAGAGTGGGCGAAGACACACCAGGCAGCTTCACGAACCTCTCTTGTAGTGTCAACTCTTGTTGACGGAGGTGCTAC
TTGCGTCGGTAAAACTGTTATTGATGAACTTGCTTATAGTATTCATGGAGAAAATAAGCATTATGGTACACCTATCAATC
CTGTTGTGCCTGCACGAGTACCTGGTGGATCCTGTAGTGGAGCTGCTGTGGCTGTGGCTGCTAATCTGGTTGACTTTTCT
TTGGGTGTTGATACTGTCGGTGGTGTGAGAGTTCCTGCTGGATTTTGTGGTGTCATAGGATTTCGACCCTCATATGGAGC
TATTTCAAAGACAGGAGTCTTACCTGTTTCGGCCAGTCTTGACACTGTTGGTTGGTTTGCTAAGGATCCTAATATTCTAC
GACGTGTTGGTCATGTTCTTCTTCAACCTGCTTTTGGAGGTCAACGTAGTCCTAGGCAAATTATAATGGCAGAGGACTGT
TTTCAATTACTAAAGATTCCTGTTGATAGAGTTGCTCAGGTGGTGGTTAACTCAACTGAAAAGCATTTCGGAAGACAAGT
TTTGAAGCATGAAATTCTTGACGTGTATCTGAATTCTAAAGTTCCAAGCTTGAAAGAGTTCCATAACAAGAAAAAAAATG
GTGATGTTAAAACTTCTTCAATAAGATTGCTTGCACATGTCATGCAGCTTCTTCATAGATATGAGTTCAGAAGCAATCAT
GAGGAATGGATTAACACAGAAAAGCCAATTCTTGAACCTGATTTCTCAGCACAGATGAATGAAATAATGAAGATATCAGA
GGCAGAGATTGAACTCTGCAAGTCAATTAGAGAAGAAATGCGTTTGGCTATCAACTCTCTATTGAAGGATGATGGGATAC
TGGTGGTCCCTACAATGGCTTATCTTCCTCCAAAACTTGATGGGAAGGAGATTTTATCTGAAGAATATAAGAGCTCTTCA
TTTAGTCTTTTGAGCATTGCTAGCCTATCAGGTTGCTGTCAGGTCACTGTGCCATTAGGATATTACGACAAGTGTCCTGT
TTCAGTGTCCTTGATAGCCAGGCATGGAAATGATCGCTTTTTACTAGATACACTGCAGACCATGTATGCATCTCTGCAAG
AACAGGCAGAGACACATGTGAAATCTAAATCAAGGAACACAGACAGCGGGGAAAATTCTGCTGAGATGGCTAAAGAAAAG
GGCAATCAAGCATTTAAGGAGAAGCAGTGGAAGAAGGCTATTAGCTATTATAATGAAGCTATCAAACTTAACGACAAGAA
TGCAACATATTACAGTAACAGAGCTGCAGCATATCTTGAACTGGGAAGTTTCCATCAAGCTGAAGCAGATTGTTCAAAGG
CTATCAACCTTGATAAAAAGAATGTAAAGGCCTATTTGCGAAGAGGGACAGCAAGAGAGATGCTTGGTTATTACAAGGAT
GCAATTGAAGATTTCAAATATGCCCTGGTCCTTGAGCCAACTAATAAAAGAGCATCCCTTTCTGCTGAGAGATTAAGGAA
AGTTTTTCCAGTAGGTTATTGA