Details for Western poplar Locus Potri.012G045200

Position : Chr12 ( 5`- 4139032 .. 4144570 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G045200

Protein [Map View]
MASMSRTLTRNFRNTLQLRSGGSLDSLPKYWIPSSSSSSPFCSSASAATISAQPPEKESGSRLSKWLLFLPGAITFGLGT
WQVLRRQDKIKMLEYREGRLAMEPMKFNDISPSSEQLDDLEFRRVACKGVFYDKMSIYVGPRSRNISGITENGYYIITPL
MPVSKNPECVQSPILVNRGWVPRSWKDNSLEVSQDDEQPSDIAMASAQGSEKSSWWRFWSRKPKTIEEKIPSIAPVEVVG
VVRGSEKPSIFVPANDPSSFQWFYVDVPAIARVCGLPENTIYVEDINENFNSGCPYPVPKDVNALIRSSVMPQDHLNYTL
TWYSLSAAVTFMAFKRLRPKKSRR*

DNA
ATGGCTTCCATGTCCAGAACTCTAACAAGGAATTTCCGTAACACTCTTCAGCTTAGAAGTGGCGGGTCCCTCGACTCCCT
TCCGAAATATTGGATCCCGTCTTCATCTTCATCATCTCCCTTTTGTAGCTCCGCTTCTGCTGCCACCATCTCTGCACAGC
CTCCAGAAAAAGAGAGTGGTTCAAGATTGTCAAAATGGTTACTCTTTTTACCTGGAGCTATCACTTTTGGCCTTGGAACT
TGGCAGGTTCTTAGAAGGCAGGACAAGATCAAAATGCTGGAATATAGAGAGGGGAGATTGGCAATGGAACCGATGAAGTT
CAATGATATATCTCCATCTAGTGAACAGCTGGATGATTTAGAGTTCAGAAGAGTGGCATGCAAAGGAGTTTTTTATGATA
AAATGTCAATCTATGTGGGGCCACGTTCTAGAAATATTTCTGGAATCACTGAAAATGGCTACTATATCATTACACCACTT
ATGCCAGTCTCCAAAAACCCTGAGTGTGTGCAGTCACCGATTCTTGTCAATAGAGGATGGGTACCCCGTAGCTGGAAAGA
CAATTCTTTGGAAGTTTCACAAGATGATGAACAACCTTCAGATATAGCAATGGCATCTGCCCAAGGGAGTGAGAAAAGCT
CTTGGTGGAGATTTTGGTCCAGAAAGCCAAAAACTATTGAGGAAAAAATCCCTTCCATCGCTCCTGTAGAAGTTGTTGGA
GTCGTTCGTGGTAGTGAAAAACCCAGCATTTTTGTTCCTGCAAATGATCCAAGCTCCTTCCAGTGGTTCTATGTTGATGT
TCCCGCAATTGCCCGTGTTTGTGGGCTTCCTGAGAATACCATATATGTGGAAGACATTAATGAAAACTTTAATTCAGGCT
GTCCTTACCCTGTACCCAAGGATGTTAATGCCTTGATTCGAAGTTCAGTCATGCCACAGGACCATCTCAATTATACACTG
ACCTGGTATTCTCTCTCTGCTGCTGTAACATTCATGGCCTTTAAGAGACTAAGGCCAAAAAAGAGCCGAAGATAG