Details for Western poplar Locus Potri.012G045000

Position : Chr12 ( 5`- 4124217 .. 4128845 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G045000

Protein [Map View]
MDAAKITELKHFIDQCKTCPSILHSPSLVFFKGARVPPETKPEKGDINMSDSGECYDSKRPIEDDDDDIVESDIDLDNTD
VVEPDNDPPQKMGDPAVEVTEEKQDAAQTEKAKAMDAISEGNLDEAIDHLTEAIMLNPISAILYATRASVFVKLKKPHAA
IRDADAALVINPDSAKGYKVRGMARAMLGQWEQAASELQMASKLDYDDEIGSVLKKVEPNARKIEEHRIKYERLQKEREL
RKAERERKQEAEPQEREALSALNEGQVIGIHSARELDPKLNAASKTSRLAILYFTATWCGPCRMISPIFTSLAAKYPKVV
FLKVDIDEARDVASSWNISSVPTFYFTKNGKEIDKVVGADKNGLERKIEQHAG*

DNA
ATGGATGCCGCTAAAATAACAGAACTCAAACACTTTATTGATCAGTGCAAGACTTGCCCTTCAATTCTCCACTCCCCATC
TCTTGTTTTCTTCAAAGGTGCTCGAGTTCCTCCAGAGACAAAACCGGAGAAAGGTGATATTAACATGTCTGACTCTGGGG
AATGCTATGATTCCAAAAGACCAATTGAAGATGATGATGATGATATTGTTGAGTCTGATATTGACTTGGATAATACTGAT
GTTGTGGAACCTGATAATGATCCTCCACAAAAGATGGGAGATCCTGCAGTTGAAGTTACAGAAGAAAAGCAGGATGCTGC
TCAAACTGAAAAGGCAAAAGCTATGGATGCAATTTCTGAAGGTAACCTGGATGAAGCCATAGATCATTTAACAGAAGCCA
TCATGTTGAATCCAATTTCAGCTATATTATATGCCACGCGAGCTAGTGTCTTTGTTAAACTGAAGAAACCTCATGCTGCA
ATTCGTGACGCTGATGCTGCTCTGGTAATCAATCCAGACTCTGCAAAAGGATATAAAGTACGAGGTATGGCCAGAGCCAT
GTTAGGCCAATGGGAACAAGCAGCAAGTGAGCTGCAAATGGCATCAAAGTTGGATTATGATGATGAGATTGGTTCAGTGC
TGAAAAAGGTTGAACCTAATGCACGCAAAATTGAAGAGCATCGCATAAAATATGAACGCCTGCAGAAAGAAAGGGAGCTA
AGGAAAGCTGAACGTGAAAGAAAACAAGAAGCTGAACCCCAAGAAAGAGAAGCCTTATCTGCTCTGAATGAAGGGCAAGT
TATAGGCATTCATTCTGCTAGGGAACTAGATCCCAAACTAAATGCTGCATCAAAAACTTCTCGCCTTGCAATCTTGTACT
TCACGGCAACATGGTGTGGGCCATGTCGTATGATTTCTCCCATTTTCACAAGCTTAGCTGCAAAGTACCCGAAAGTTGTT
TTCTTGAAAGTTGACATAGACGAGGCAAGGGATGTTGCTTCAAGCTGGAATATCAGCAGTGTTCCTACCTTCTACTTTAC
AAAGAATGGCAAGGAGATTGACAAGGTTGTGGGGGCTGATAAAAATGGACTGGAAAGGAAAATTGAACAACATGCAGGCT
AG