Details for Western poplar Locus Potri.012G044900

Position : Chr12 ( 5`- 4116344 .. 4120741 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G044900

Protein [Map View]
MERDFLGLGTINNPLTIKEATTDTPNKDSVAMRGSGMQWSFSNKVSAIPQFLSFKSSLEDKPRKAVHDPVASSSGLMSIS
TADAFDSNQKTYSGLVQKNMAIDKQAGNHYPVTTYGTQQFDAYSVNRPQDTRMFSISGQQNQTITVSMSSPILQSHFPPT
GHNMLSNSIVPKPLGGVPVITPTSALPTLSSIIGTTDLRDGTKSSGAPAQLTIFYAGSVCVYDDVSPEKAQAIMFLAGNG
GSSGTPNKPISTPQAQAPIRRPPVSDIFAGNKSNTTAPISCIPSPISVTSSNTNDLATVKPVVSLASSVKQTEPPKPLNS
PGPTSATLVPAVAVPQARKASLARFLEKRKERVTQTSPYNVSKRSPESGSHGCDGASLSMNFSSSYPLPASN*

DNA
ATGGAGAGAGATTTCCTAGGTCTGGGTACGATAAATAATCCTCTTACAATCAAAGAAGCGACCACTGATACTCCCAACAA
GGATTCTGTAGCCATGAGAGGTTCAGGGATGCAGTGGTCTTTTTCAAACAAGGTTTCTGCCATTCCTCAATTCTTGTCAT
TCAAGTCTTCTCTGGAAGATAAACCAAGAAAGGCTGTTCATGATCCTGTAGCATCTTCCTCTGGCCTTATGTCTATTTCA
ACTGCTGATGCTTTTGATTCTAACCAGAAAACATACTCTGGCTTGGTTCAGAAAAACATGGCTATTGATAAACAAGCTGG
AAACCATTATCCTGTGACAACCTATGGTACACAGCAGTTCGATGCCTACTCTGTTAATCGGCCACAGGATACGAGGATGT
TCTCAATCTCCGGCCAACAAAATCAAACAATCACCGTTTCTATGAGCTCCCCCATCCTGCAGTCCCATTTTCCTCCCACA
GGACATAATATGCTTTCTAATTCAATAGTCCCAAAACCTCTGGGAGGAGTTCCAGTCATAACCCCTACATCTGCTCTTCC
CACTCTGAGTTCGATCATTGGCACCACTGATCTTAGGGATGGTACTAAATCCTCTGGAGCACCTGCTCAGTTGACCATAT
TCTATGCTGGTTCAGTGTGCGTGTATGATGATGTTTCTCCTGAGAAGGCTCAGGCCATTATGTTTTTGGCTGGAAACGGT
GGGTCTTCTGGAACGCCGAACAAGCCAATCTCTACACCTCAAGCACAGGCACCAATTCGTAGACCACCTGTCAGCGATAT
TTTTGCTGGGAACAAAAGCAACACTACAGCTCCAATCTCATGCATTCCCAGCCCTATTTCTGTGACCTCTAGTAACACCA
ACGATTTAGCAACAGTTAAGCCAGTAGTATCTTTAGCTTCTTCTGTTAAACAAACAGAGCCCCCCAAACCACTTAATTCA
CCAGGGCCTACTTCTGCCACGCTTGTTCCAGCAGTGGCTGTACCTCAGGCTCGTAAAGCATCGTTGGCTCGGTTTCTGGA
GAAGCGCAAGGAAAGGGTGACGCAAACTTCGCCATATAATGTAAGCAAGAGGTCTCCCGAGAGTGGTTCCCATGGATGTG
ATGGTGCAAGTTTATCTATGAATTTCTCTAGCTCTTACCCTCTCCCAGCCAGCAACTAG