Details for Western poplar Locus Potri.012G044700

Position : Chr12 ( 5`- 4069382 .. 4082315 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G044700

Protein [Map View]
MVFKNKLFFSSSKKSETSSPDGSNNSPRSIGSNSPIRSDKKKPAKSKDSTPTTPASTASSNNSTCKQTQVKDGVKKKDSF
FKGKETVSQPRTPTKPGISNSGSDLKSKKGGVLVDNKEKEAEKYSVSPILASSLGLNRIKTRSGPLPQETFFSFKGDKGS
GVLGSSNLSRPSASSGDGGSSSNSSSLGSGKKKEGILGQSKLRVFQESGNGGDNSDSMSTGSGGQSREVSPNLQARTRLQ
SGESSSEAGQHNSSRGHSGGLRSSDAITPETYDCDNPKESESPRFQAILRLTSAPRKRFPADIKSFSHELNSKGVRPFPF
WKPRGLNNLEEILVVIRAKFDKAKEEVNSDLAIFAADLVGILEKNADSHPEWQETIEDLLVLARSCAMTSPGEFWLQCEV
IVQELDDRRQELPPGILKQLHTRMLFILTRCTRLLQFHKERVLDGLRQSRLLHPVDKRIPSFVGRDGKVSSASRDRISSW
KPLPSPPGKSTKEVVPVEEQNDSKIEPLKTSNDRGGASDVHLAAAKVSDLPMVKDVHENSTKHQPKISWGNWGDQQNIAD
ESSIICRICEEEVPTLHVEDHLRICAIADRCDQKGLSVNERLIRISETLEKMIVQKDIHHAVGSPDVAKISNSSVTEESD
VLSPKLSDWSHRGSEDMLDCFPEADNAVFMDDLKGLPSMSCKTRFGPKSDQGMATSSAGSMTPRSPLLTPKTSHIDLLLA
GKSAFSEHDDLPQLNELADIARCVATTPLEDDRSTPYLLTCLGDLRVVIERRKFDALTVETFGTRIEKLIREKYLQLCEL
VEDEKVDIASTVIHEDTPLEDDVVRSLRTSPIHSSKDRTSIDDFEIIKPISRGAFGRVFLAKKRATGDLFAIKVLKKADM
IRKNAVESILAERDILISVRNPFVVRFFYSFTCRENLYLVMEYLNGGDLYSLLRNLGCLDEDVARVYIAEVVLALEYLHS
LRVVHRDLKPDNLLIAHDGHIKLTDFGLSKVGLINSTDDLSGPAVSGTSMLVDDEPQLSTSEHQRERRKKRSAVGTPDYL
APEILLGTGHGTTADWWSVGVILFELIVGIPPFNAEHPQTIFDNILNCKIPWPRVPEEMSPEAQDLIDRLLTEDPYQRLG
AGGASEVKQHVFFKDINWDTLARQKAAFVPSSESALDTSYFTSRYSWNTSDDAIYPASDFEDSSDADSLSGSSSCLSNRH
DEVGDECQGLAEFESGSGVNYSFSNFSFKNLSQLASINYDILSKGWKDDPPTTNL*

DNA
ATGGTGTTCAAGAACAAGCTATTTTTCTCATCTTCAAAGAAATCAGAGACTTCAAGTCCTGATGGATCCAACAACAGTCC
AAGATCAATCGGGTCAAATTCACCGATCCGGTCCGACAAGAAAAAACCCGCCAAATCTAAAGATTCAACACCTACTACTC
CAGCTAGCACTGCTTCTTCTAATAATTCTACTTGCAAGCAAACCCAAGTTAAAGATGGGGTAAAAAAGAAAGACTCATTT
TTTAAAGGCAAAGAAACTGTGAGCCAACCTCGAACTCCTACCAAACCCGGGATTTCAAATTCTGGGTCGGATTTAAAATC
CAAAAAAGGTGGTGTCTTGGTTGATAATAAGGAGAAAGAAGCAGAAAAGTATTCTGTTTCGCCGATTTTAGCTTCATCTT
TGGGGTTGAATAGGATCAAAACAAGATCAGGGCCATTGCCACAAGAGACTTTCTTTAGTTTTAAAGGTGATAAAGGGAGT
GGTGTATTGGGGTCTAGTAATTTGTCAAGGCCTAGTGCTAGTAGTGGGGATGGGGGGTCGAGTTCGAATTCAAGTTCTTT
AGGGTCAGGAAAGAAGAAGGAAGGAATATTGGGGCAGAGTAAGTTGAGGGTGTTTCAAGAGAGTGGTAACGGAGGTGATA
ATTCGGATAGTATGTCTACTGGAAGTGGAGGACAGTCTAGAGAAGTTAGTCCGAATTTGCAGGCAAGAACTAGGTTGCAA
AGTGGAGAGTCATCAAGCGAAGCAGGTCAACATAATTCATCACGGGGTCACTCTGGAGGCTTACGAAGTTCAGATGCTAT
CACACCTGAGACTTATGATTGTGACAACCCAAAGGAATCTGAATCTCCCAGGTTTCAAGCAATACTCCGTTTGACAAGTG
CCCCTAGAAAGAGGTTTCCTGCTGACATAAAAAGTTTCTCACATGAATTAAATTCCAAAGGTGTACGGCCTTTCCCATTT
TGGAAGCCTCGAGGGCTAAATAACTTGGAGGAAATCTTGGTTGTCATACGTGCAAAATTTGACAAAGCAAAGGAAGAAGT
GAATTCTGACCTGGCTATCTTTGCAGCGGATCTGGTTGGAATTCTTGAAAAAAATGCGGATAGTCATCCTGAGTGGCAGG
AAACTATTGAAGACTTGTTGGTTTTGGCTCGGAGTTGCGCTATGACATCACCTGGAGAGTTTTGGCTTCAATGTGAAGTT
ATAGTCCAAGAACTGGATGATAGACGCCAAGAACTTCCCCCAGGAATTTTGAAGCAACTTCATACCCGAATGCTTTTCAT
CCTAACAAGGTGTACCAGATTATTGCAATTCCACAAGGAAAGGGTGCTGGACGGGCTTCGTCAATCTAGGCTTTTGCATC
CTGTAGATAAACGAATTCCTTCTTTTGTTGGTAGGGATGGGAAAGTTTCTAGTGCAAGCAGGGATCGGATATCTTCTTGG
AAGCCACTCCCATCTCCTCCTGGCAAAAGCACAAAGGAAGTTGTTCCTGTAGAGGAGCAGAATGACAGTAAGATTGAACC
TTTGAAAACTTCAAATGACAGGGGAGGAGCCTCTGATGTGCATCTGGCTGCTGCAAAGGTTTCTGACCTTCCAATGGTGA
AAGATGTGCATGAAAATTCTACGAAGCACCAACCTAAAATTTCTTGGGGAAACTGGGGCGATCAGCAGAATATTGCTGAT
GAGAGTTCAATAATTTGTCGCATTTGTGAGGAGGAAGTTCCGACTTTACATGTAGAAGATCATTTAAGAATTTGTGCAAT
TGCAGATCGATGTGATCAGAAGGGTCTAAGTGTCAACGAGCGCTTGATCAGAATTTCCGAAACACTTGAGAAGATGATAG
TCCAGAAGGATATTCATCATGCAGTGGGAAGCCCAGATGTTGCTAAAATATCAAATTCTAGTGTGACTGAAGAATCTGAT
GTTCTCTCTCCAAAACTCAGTGATTGGTCTCATAGAGGGTCAGAGGACATGCTTGACTGCTTCCCTGAAGCTGACAATGC
TGTTTTTATGGATGACCTGAAAGGGTTGCCTTCCATGTCATGTAAAACCCGATTTGGTCCCAAGTCTGATCAAGGAATGG
CCACATCATCAGCTGGTAGCATGACTCCTAGATCTCCATTATTGACACCAAAGACCAGTCATATAGACTTGCTTTTAGCA
GGGAAGAGTGCTTTTTCCGAGCATGATGATCTTCCTCAGCTGAATGAACTTGCCGATATTGCAAGATGTGTAGCAACTAC
ACCTCTAGAGGATGATCGCTCCACTCCCTATTTGCTAACTTGTCTTGGAGACTTGAGGGTTGTCATTGAGCGGAGAAAGT
TTGATGCGCTTACTGTGGAGACTTTTGGAACAAGAATTGAGAAGCTTATTCGGGAGAAATATTTGCAGCTTTGCGAGCTA
GTGGAAGATGAGAAGGTTGATATAGCAAGTACTGTAATTCATGAAGATACACCTTTGGAAGATGATGTTGTTCGAAGCTT
GAGAACAAGTCCAATACATTCTTCTAAGGATCGTACCTCCATAGATGACTTCGAGATAATAAAACCAATAAGTCGTGGGG
CATTTGGAAGGGTGTTTTTAGCTAAAAAGAGAGCAACAGGAGACCTTTTTGCCATAAAGGTTCTTAAAAAGGCTGATATG
ATCCGCAAGAATGCTGTTGAAAGTATACTAGCAGAACGAGATATTTTAATTTCAGTCCGCAATCCCTTTGTGGTTCGCTT
CTTCTATTCATTTACTTGTCGTGAGAATTTGTATCTTGTGATGGAGTATTTGAATGGTGGCGATCTGTATTCATTGTTGA
GAAATTTGGGCTGCTTAGATGAAGATGTTGCTCGTGTATACATTGCAGAAGTTGTGCTCGCTTTGGAATATTTGCACTCA
CTGCGTGTAGTTCATCGTGATTTGAAGCCAGATAATTTGTTGATTGCACATGATGGACATATCAAGCTGACAGACTTTGG
TCTTTCCAAGGTTGGTCTCATCAATAGCACCGATGATTTATCTGGTCCAGCAGTTAGCGGGACTTCCATGCTTGTGGATG
ATGAACCTCAACTATCTACTTCCGAGCATCAGCGAGAAAGGCGGAAAAAACGTTCTGCTGTGGGCACACCTGATTATCTT
GCACCAGAGATTCTTCTGGGAACAGGACATGGAACAACTGCTGATTGGTGGTCTGTGGGTGTTATTTTATTTGAATTGAT
TGTTGGTATTCCACCCTTTAATGCAGAGCATCCCCAGACGATATTTGATAATATTCTCAACTGTAAGATACCTTGGCCAC
GGGTGCCTGAGGAAATGAGTCCTGAAGCACAGGATCTAATTGATAGATTATTAACTGAAGATCCTTACCAGAGACTTGGA
GCTGGAGGAGCATCAGAGGTAAAGCAGCATGTATTCTTTAAAGATATCAACTGGGACACACTTGCCAGGCAAAAGGCTGC
ATTTGTGCCCAGTTCAGAGAGTGCACTTGATACAAGCTACTTCACTAGTCGATACTCTTGGAATACTTCAGATGATGCAA
TATACCCAGCCAGTGACTTTGAGGATTCGAGTGATGCAGATAGCTTGAGTGGCAGCAGTAGCTGCTTAAGCAATCGCCAT
GATGAAGTGGGAGATGAATGTCAAGGTCTTGCTGAATTTGAGTCTGGTTCAGGTGTCAATTACTCCTTCAGTAATTTTTC
ATTCAAGAATCTCTCCCAGCTTGCATCAATCAACTATGATATTCTCTCTAAGGGTTGGAAGGATGATCCACCAACAACTA
ATTTATGA