Details for Western poplar Locus Potri.012G043300

Position : Chr12 ( 5`- 3914420 .. 3917231 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G043300

Protein [Map View]
VSLDAAKVVNVTPRYAQLRAGANGSAKGQIIGWENIELVKEYPDRTLIASIMEEYDKAAWEELIDRVEQTGIDALEINFS
CPHGMPERKMGAAVGQDCALLEEPARVALLSLCEGVSAINTIMSVMGINLKTLRPEPCVEGYSTPGGYSSKSVHPIALEK
VMSIAKMMKSEFDLDQHSLSGIGVVETGGDAAEFILLGANTVQVCTGVMMHGYGLVKKLCEELKDFMKMHNFSSIEDFRG
ASLEYFTTHMDLVRRQQEAMQQRKAIKTGLQSDKDCTGDGFVKESESMVSN*

DNA
GTGTCACTAGATGCAGCGAAAGTTGTAAATGTAACTCCTCGATATGCTCAGCTACGAGCAGGTGCAAATGGCTCAGCCAA
GGGGCAAATTATTGGTTGGGAGAATATAGAACTCGTAAAAGAATATCCTGATAGGACTCTCATTGCTTCAATCATGGAGG
AGTATGACAAAGCTGCTTGGGAGGAACTCATTGACCGAGTAGAGCAAACTGGAATTGATGCCTTAGAAATCAATTTCTCA
TGTCCTCATGGAATGCCTGAGCGTAAAATGGGTGCTGCAGTTGGCCAAGATTGTGCGCTATTGGAAGAGCCAGCTAGGGT
GGCATTACTATCCTTATGCGAGGGAGTGTCTGCTATTAATACCATCATGAGTGTTATGGGAATAAATCTGAAAACCTTAC
GGCCAGAGCCTTGTGTTGAAGGATATTCAACTCCTGGGGGTTACTCTTCCAAATCAGTCCATCCTATTGCACTAGAGAAA
GTAATGAGTATTGCTAAAATGATGAAATCAGAATTTGATTTGGACCAACACTCACTTTCTGGTATTGGAGTTGTTGAGAC
CGGTGGTGATGCTGCCGAGTTTATTCTTCTCGGAGCAAATACAGTTCAGGTCTGCACTGGGGTTATGATGCATGGATATG
GCCTTGTGAAGAAACTCTGTGAAGAGCTGAAGGATTTCATGAAAATGCACAACTTCTCATCAATAGAAGATTTCAGAGGA
GCATCTCTTGAGTATTTCACAACGCACATGGATTTGGTGCGCCGGCAACAAGAAGCCATGCAACAGAGGAAAGCTATCAA
GACAGGTTTGCAGTCTGACAAGGATTGCACTGGAGATGGTTTTGTTAAGGAGTCGGAGAGCATGGTTTCCAACTAA