Details for Western poplar Locus Potri.012G042700

Position : Chr12 ( 5`- 3854566 .. 3857398 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G042700

Protein [Map View]
MALQWMILTYLVAAEAVIAVLLTLPSPKLLKYRLVSLISLVLQPALFVVPFAGFQLLDIYWKMEHRLMCTGETCTAAERD
RYEKSSAVQIYKAQRNVILCISACLLYWCVYRVCKFYKEIQSLEEVEKRYKDQ*

DNA
ATGGCGTTGCAATGGATGATACTGACATACCTAGTGGCAGCAGAGGCAGTAATAGCGGTACTCTTAACACTACCGTCGCC
AAAGCTATTGAAGTACCGATTGGTTTCTCTCATCTCTCTCGTTCTCCAGCCGGCTCTCTTTGTTGTCCCTTTTGCCGGAT
TCCAGCTCCTGGATATATATTGGAAAATGGAGCATCGATTGATGTGCACTGGTGAGACCTGCACCGCTGCTGAAAGAGAT
CGTTATGAGAAATCTTCTGCTGTGCAGATCTACAAAGCTCAAAGGAATGTCATTCTTTGCATTTCAGCATGCCTTCTCTA
CTGGTGTGTTTATCGTGTATGCAAATTTTACAAGGAGATTCAGAGCTTGGAGGAAGTAGAGAAGAGGTACAAGGACCAGT
AG