Details for Western poplar Locus Potri.012G041100

Position : Chr12 ( 5`- 3689772 .. 3702214 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G041100

Protein [Map View]
MASQGKKLINDPNDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADHASAMLDKVAIISGGGSGHEPAHAGFVGEGMLSA
AICGEVFTSPQVDAILAGIRAVTGPMGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGDDCALPPPRGIAGRRGLA
GTILVHKVAGAAAAAGLSLDEVAAEAKRASEMVGTMGVALSVGTLPGQVTSDRLGPGKMELGLGIHGEPGAALADLQPVE
VVVSHVLQQILSPETNYVPITRGNRVVLLVNGLGATPGMELMIAAGKAVPQLQLEHGLAVDRVYTGSFMTSLDMAGFSIS
IMKADEAFLQRLDAATKAPYWPVGVDGNRPPAKIPVPLPLSHSAKSDESLSRPQQLSEQGHLLEVAIEAAVNAIIDLRDN
LNEWDGRVGDGDCGSTMYRGATAILEDMKKHYPLNDAAETVNEIGSSIRRVMGGTSGIIYTIFCKAACVQLKANTQSVVA
SKQWAEALEASIAAVSKYGGASAGFRTLLDALIPASAVLQERLNAGDDPCTAFLLSSEAAVAGAESTKHMQAQAGRSTYI
SSDILATVPDPGAMAAAAWYRAAAIAIKNNYQLHE*

DNA
ATGGCTTCTCAAGGAAAGAAACTCATTAACGACCCTAACGATGTAGTAACTGAGTTCATTGAAGGTCTTGTGGAAACCTA
CCCTGGATTACAGTACCTGGATGGCTTTCCGGAGGTTAAGGTTGTGTTACGTGCTGATCATGCGAGTGCTATGCTTGACA
AAGTTGCGATTATATCAGGAGGAGGAAGTGGGCACGAACCTGCCCATGCTGGATTTGTCGGAGAAGGGATGCTAAGTGCT
GCTATCTGTGGAGAAGTTTTTACTTCCCCCCAAGTTGATGCAATTCTAGCTGGTATCCGAGCTGTAACTGGTCCGATGGG
ATGTCTTCTGATTGTCAAGAATTATACTGGCGATCGTCTAAATTTTGGTTTGGCTGCTGAGCAAGCAAAATCTGAAGGTT
ATAAAGTAGAGACTGTAATTGTTGGAGATGACTGTGCTTTACCTCCACCTCGAGGCATAGCTGGACGAAGAGGGTTGGCG
GGGACTATTCTTGTTCATAAGGTTGCTGGAGCTGCAGCTGCTGCTGGCCTTTCTCTTGATGAAGTTGCTGCAGAAGCGAA
ACGTGCATCTGAAATGGTTGGAACAATGGGTGTTGCATTGTCAGTCGGTACACTGCCTGGTCAGGTTACATCAGATCGTT
TGGGCCCAGGAAAGATGGAACTAGGTCTTGGAATTCATGGTGAACCTGGTGCTGCTTTAGCGGACCTTCAGCCTGTCGAA
GTGGTGGTTTCTCATGTTCTTCAACAAATTCTATCACCGGAGACTAACTATGTCCCAATTACTCGCGGCAATAGAGTGGT
ACTCTTGGTCAATGGACTAGGCGCCACCCCTGGTATGGAGTTAATGATTGCAGCAGGAAAAGCAGTTCCTCAGTTGCAGC
TTGAACATGGATTGGCTGTCGATAGAGTGTATACTGGATCTTTTATGACTTCCCTTGATATGGCAGGATTCTCAATTTCC
ATAATGAAGGCAGATGAAGCATTTTTGCAACGATTGGATGCTGCTACCAAGGCTCCATACTGGCCTGTTGGAGTAGATGG
TAATCGCCCACCTGCCAAGATACCTGTTCCACTGCCACTGTCTCATTCAGCAAAGAGTGATGAGTCTTTAAGTCGGCCGC
AACAGCTTAGTGAACAAGGGCATCTTCTTGAGGTGGCTATTGAAGCAGCAGTGAATGCGATCATTGATCTTAGGGACAAT
TTAAATGAATGGGATGGCAGAGTAGGTGATGGTGACTGTGGATCAACAATGTATAGGGGTGCAACAGCAATTCTAGAGGA
CATGAAGAAGCATTATCCCTTGAATGATGCTGCAGAAACAGTGAACGAAATTGGATCATCTATCAGAAGAGTTATGGGAG
GAACCAGTGGAATTATATATACCATATTCTGCAAGGCAGCTTGTGTGCAGTTGAAAGCAAACACCCAGTCAGTTGTCGCA
TCGAAACAATGGGCTGAAGCACTTGAAGCTTCCATAGCTGCAGTCAGTAAATATGGTGGCGCTAGTGCTGGATTTCGCAC
ATTGTTAGATGCCCTTATTCCAGCTTCAGCTGTTCTTCAGGAGAGGCTAAATGCCGGGGATGATCCTTGCACTGCTTTTC
TTCTCTCATCTGAAGCAGCAGTGGCTGGAGCCGAATCAACCAAACACATGCAAGCACAGGCTGGTCGCTCAACATACATC
TCCTCAGACATTCTTGCCACCGTGCCTGACCCTGGGGCCATGGCTGCAGCTGCATGGTATAGAGCAGCTGCCATAGCTAT
CAAAAACAACTACCAGCTTCATGAGTAG