Details for Western poplar Locus Potri.012G038000

Position : Chr12 ( 5`- 3362323 .. 3363573 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G038000

Protein [Map View]
MGDFSLLQNTPVELPTEGVDERVKMLLEYFKSEEDMGCGDSFAERAEWYYQKRPQLLALLRDLYNGYTALADRCSRMEKG
KKLSNHFSYPMLMALDDDQDQEGSGGSSSCQFLDWDAESSMSYQQPTTPFQDGSDTVLGIDEVVVDLVMKNVENDILADQ
LSEMEKQQQGQESIWRKVELLKKLLEVLESERIDLQGQIYGLEMRNKDYYLQLLRKELQGEEKISSRKDDGVAFVGCCFQ
IEKLKLKKKDGASVSKGGAKKRPKWWEKIKSMDLFMCGFQCSP*

DNA
ATGGGGGACTTCTCTTTACTTCAAAACACCCCAGTTGAGTTACCTACAGAGGGAGTTGATGAGAGAGTGAAAATGTTGCT
CGAGTACTTCAAATCAGAAGAAGACATGGGATGTGGCGACAGCTTTGCAGAGAGAGCTGAATGGTACTATCAGAAACGCC
CTCAACTTCTTGCTTTACTTCGAGACTTGTACAATGGGTACACAGCCTTGGCGGACAGATGCAGTAGAATGGAAAAGGGC
AAGAAACTTAGCAATCATTTCTCATATCCGATGTTAATGGCTCTTGATGATGACCAAGATCAAGAAGGTAGTGGTGGATC
TAGCAGCTGCCAGTTTCTTGATTGGGATGCTGAGAGTTCTATGTCTTACCAACAACCAACAACCCCCTTTCAAGATGGCA
GTGATACCGTTCTTGGCATCGATGAGGTTGTAGTTGATCTTGTAATGAAGAATGTAGAGAACGATATATTAGCAGACCAG
CTTAGTGAAATGGAGAAGCAGCAGCAAGGCCAAGAATCAATATGGAGAAAAGTAGAGCTATTAAAGAAACTTCTTGAGGT
GTTAGAGTCAGAGAGGATAGATCTTCAAGGACAGATATATGGGTTGGAGATGAGAAACAAGGACTACTATCTGCAGTTGT
TGAGGAAAGAGCTGCAAGGAGAAGAGAAAATCAGCAGCAGAAAAGATGATGGCGTCGCTTTTGTAGGCTGTTGCTTTCAA
ATAGAGAAACTGAAATTGAAGAAAAAGGATGGAGCTTCTGTTAGTAAAGGTGGTGCAAAGAAACGGCCAAAATGGTGGGA
AAAGATCAAGAGCATGGACTTGTTTATGTGTGGCTTTCAGTGTTCCCCTTGA