Details for Western poplar Locus Potri.012G036900

Position : Chr12 ( 5`- 3284198 .. 3287914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.012G036900

Protein [Map View]
MNSKASVSKELNARHTKILEGLLKLQENRECADCHSKAPRWASVNLGIFICMQCSGTHRGLGVHISQVRSTTLDTWLPEQ
VAFMQSVGNRRSNSFWEAELPPNVDRSGIDRFIHAKYGEKRWVSRNSKQPTEVLSRINYTNDMLVEGAASRVVPRQTRPQ
SLDEESFTRITAQLSPPITRPRWASLDMKSDPIAFPTPKGLTESIKRTDGPTDLYSLLYVDDTQQNTSSMATPSSWATFD
*

DNA
ATGAACAGCAAAGCCTCTGTCTCTAAGGAGCTTAATGCCAGGCACACCAAGATATTAGAGGGCCTTCTTAAGCTGCAGGA
GAACAGAGAATGCGCTGATTGTCATAGCAAGGCACCGCGATGGGCAAGTGTGAACCTTGGAATATTTATATGCATGCAAT
GTTCAGGAACTCATCGGGGTCTTGGGGTGCATATTTCACAGGTACGGTCTACCACACTGGATACATGGTTGCCAGAGCAG
GTTGCTTTCATGCAATCCGTGGGTAACAGGAGATCCAATAGTTTCTGGGAAGCAGAACTGCCTCCAAATGTTGACAGAAG
TGGGATTGACAGATTTATCCATGCTAAGTATGGGGAGAAAAGATGGGTTTCAAGAAATTCAAAGCAACCAACTGAAGTTT
TAAGTCGAATTAACTATACTAATGACATGTTGGTAGAAGGTGCAGCTAGTAGGGTTGTTCCGAGGCAAACACGGCCACAG
TCTCTTGACGAAGAGAGTTTTACCAGGATCACAGCACAACTTTCTCCTCCAATTACAAGACCTCGTTGGGCTTCGTTGGA
CATGAAGAGCGATCCAATTGCTTTTCCTACACCAAAGGGACTAACTGAGAGCATAAAGAGGACCGATGGTCCTACAGACC
TCTACAGCTTGCTTTATGTCGATGATACGCAACAAAATACCTCTTCCATGGCAACTCCTTCGAGCTGGGCAACTTTTGAT
TGA