Details for Western poplar Locus Potri.003G039800

Position : Chr03 ( 5`- 5286367 .. 5288809 -3` )
Annotation :
External links : CoGe
PGDD synteny : Potri.003G039800

Protein [Map View]
MDQSFSGGGSWTVIPSVPTHSGSPAHSNQDQFYLSPQQQQPQFTQFQQQQQFNQQQQQFQQQQQYQQQQSQQQRFIQQQQ
QQQPQVQQQNHHHQSLASHFHLLQLAENLADAIENGTRDQHSDALVNELNTHFDKCQQLLNSISSSINAKAMTVEGQKRK
LEESEQLLNQRRELIGKYRNSVEELLKSEP*

DNA
ATGGATCAATCATTCAGTGGAGGAGGGAGCTGGACAGTGATCCCAAGCGTTCCGACACACAGTGGCTCGCCTGCACACTC
AAATCAAGACCAGTTTTACCTCTCTCCACAGCAGCAACAACCACAATTTACTCAGTTTCAGCAGCAGCAGCAGTTTAACC
AGCAGCAACAACAATTTCAACAGCAGCAGCAATATCAGCAACAACAGTCCCAGCAACAACGTTTTATTCAACAACAGCAA
CAGCAACAACCGCAAGTGCAGCAACAGAACCATCACCACCAATCATTGGCTTCACACTTTCATCTCTTACAGTTGGCGGA
GAACTTAGCTGATGCTATTGAGAATGGAACTCGGGATCAGCATTCTGATGCTTTGGTCAATGAATTGAACACTCACTTTG
ACAAGTGTCAGCAGCTGTTGAATTCCATTTCAAGCTCAATTAATGCTAAAGCCATGACAGTTGAGGGACAAAAGCGAAAG
CTGGAGGAAAGTGAACAATTGCTAAATCAAAGGAGGGAGCTAATTGGCAAGTATAGAAATTCTGTTGAAGAGCTTCTCAA
GTCTGAGCCATGA