Details for Mei Locus Pm025266

Position : Pm7 ( 5`- 16830509 .. 16836367 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm025266

Protein [Map View]
MGDSNSVDVILDFLRKNRFSRAEAALRSELSNRPDLNGFLQKLTLEEKDLGNSLEAENGDKLVVENQGLGSRNGGEVSKE
LIVKEIEYGTGRNGSESKWKNTASIGERNKTIEVAGTNHKSFAFSKGLEDTVLDLYSWKVNPSNGPmEPCQNDGDGSINN
YPEPQISHQSRNHTAEVPDSGKAIVKYGEEILFSGKKKTSWAGSTSKANVELKYDRTQTSEPKELDQQLKTSTSFLKENV
ADNPWSRIEEPSNSPSEMWKDCSVKTVFPFSKGDVPTSYDSASASDKKEGKRKAELTDIRATIKDQVDEVGRALYLSKSQ
GSSEQNTISSLVFPILPENQKEEFPRLPPVKLKSEDKPLNINWEEKFERDVPGSKLSAADNALLIGSYLDVPIGQEINSS
GGKRNVGGGSWLSVSQGIAEDTSDLVSGFATVGDGLSESVDYPNEYWDSDEYDDDDDVGYMRQPIEDEAWFLAHEIDYPS
DNEKGTGHGSVPDPQERGPTKDEDDDQSFAEEDSYFSGERYFQAKNVEPIVTSDDPIGLTVTELYGRSDENDLIAQYDGQ
LMDEEELNLMRAEPVWQGFVTQTNELIMLGDGKVLNECGRSRLDDVCVDDDQLGSVRSIGVGINSDAADIGSEVRESLVG
GSSEGDLEYFRDHDVGIGGPRKHHHESDKKNIDRSNKDKKKTSKQEANKYVVETDTGISRQKKNHTEGVFSFPPPLRDGQ
LVQASSSKSLWSNNCNAVVTDETDDCMVDSDNMLASWRQKSNDSSPRMSSRDENNANAVRSTNSTPSTLSNYAYAEREHA
KQEEEDKIAAVREEDTGASLEDEEAAAVQEQVRQIKAQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLNSVIAGRYHVTE
YLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNKHDPmDKYHILRLYDYFYYREHLLIVCELLKA
NLYEFHKFNRESGGEVYFTMPRLQSITTQCLEALQFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCSY
VQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSPmTLLARVMGIICPIDQSMLAKGRDTYKYFTKNHML
YERNQETNRLEYLIPKKTSLRHRLPMGDQGFIDFVAHLLEINPKKRPSASEALKHPWLSYPYEPISS

DNA
ATGGGGGACTCAAACTCCGTTGATGTGATTCTGGACTTTCTGCGGAAGAATAGGTTTTCAAGAGCTGAGGCAGCTCTTCG
CAGTGAGCTCAGTAATCGTCCTGATTTGAATGGTTTCCTTCAGAAGCTTACTCTTGAAGAGAAGGACTTGGGTAATTCGT
TGGAAGCTGAAAATGGGGACAAATTGGTGGTGGAAAATCAAGGGTTGGGGTCTAGGAATGGTGGTGAAGTTTCTAAGGAA
CTTATAGTGAAAGAGATAGAGTATGGAACTGGTAGAAATGGGTCTGAAAGCAAATGGAAAAATACTGCTTCTATTGGGGA
GCGGAATAAAACTATTGAGGTGGCTGGGACAAATCACAAGAGCTTCGCATTCTCTAAAGGTTTAGAGGACACAGTGCTTG
ATTTATATTCATGGAAGGTCAATCCTAGCAATGGACCTGCAGAACCTTGTCAAAATGATGGAGATGGTAGTATCAATAAC
TACCCAGAGCCTCAGATATCCCACCAATCAAGGAATCATACAGCTGAGGTTCCTGATTCGGGTAAAGCCATTGTGAAATA
CGGAGAAGAGATTCTCTTTTCTGGCAAAAAGAAAACTTCTTGGGCTGGAAGTACTAGCAAAGCTAATGTGGAATTGAAGT
ACGACAGAACCCAAACAAGTGAACCTAAGGAACTTGACCAACAACTTAAGACAAGTACCTCATTCTTGAAAGAAAATGTA
GCAGATAATCCATGGTCAAGAATTGAAGAACCTTCAAATTCACCTTCAGAGATGTGGAAAGATTGTTCTGTCAAGACGGT
ATTTCCATTCTCCAAGGGGGACGTGCCAACAAGTTATGATAGTGCTTCTGCTTCTGACAAAAAAGAAGGAAAGAGAAAAG
CTGAGTTGACTGATATTAGGGCAACAATAAAGGATCAGGTTGATGAGGTGGGAAGAGCTTTATACTTAAGCAAGTCACAA
GGGAGTTCTGAGCAAAATACCATCAGTAGCTTAGTTTTTCCTATTCTTCCTGAGAATCAAAAGGAAGAGTTCCCTAGGCT
GCCACCTGTCAAACTCAAGTCAGAGGACAAACCATTGAATATTAATTGGGAGGAAAAGTTTGAGCGAGATGTACCTGGCT
CAAAACTCAGCGCTGCTGACAATGCTCTTCTTATTGGGTCATATTTGGATGTCCCTATTGGACAAGAAATCAATTCTTCA
GGTGGAAAAAGGAATGTAGGAGGAGGCAGTTGGCTGTCTGTAAGTCAGGGGATTGCAGAGGATACATCTGATCTAGTTTC
TGGTTTTGCTACTGTTGGTGATGGATTGAGTGAATCTGTTGACTATCCAAACGAGTATTGGGACTCTGATGAATATGATG
ATGATGATGATGTGGGATACATGAGACAGCCTATTGAAGATGAGGCCTGGTTTCTGGCCCATGAAATCGATTACCCAAGT
GACAATGAAAAGGGAACAGGGCATGGGAGTGTTCCGGATCCACAGGAAAGAGGTCCAACCAAAGATGAGGATGATGACCA
ATCTTTTGCTGAGGAGGATTCTTACTTTTCTGGTGAGCGGTACTTTCAAGCGAAAAATGTTGAACCAATTGTAACTTCAG
ATGATCCTATAGGACTAACAGTGACTGAATTGTATGGGAGGAGTGATGAGAATGATTTAATAGCTCAATATGATGGACAG
TTGATGGATGAAGAGGAACTTAATTTGATGCGTGCAGAACCTGTCTGGCAGGGCTTTGTCACTCAGACTAATGAACTCAT
CATGTTAGGGGATGGGAAAGTTCTGAATGAGTGTGGAAGGTCACGTCTAGATGATGTTTGTGTGGATGATGATCAGCTTG
GTTCAGTAAGATCAATAGGTGTGGGAATCAATAGTGATGCTGCTGATATTGGCAGTGAAGTACGGGAAAGTTTGGTTGGA
GGCAGTAGTGAAGGGGATCTAGAATATTTTCGAGACCATGATGTAGGAATTGGTGGGCCCCGGAAGCATCATCATGAATC
AGATAAGAAAAACATTGATAGATCTAACAAGGACAAAAAGAAAACTAGTAAACAAGAGGCAAATAAATATGTAGTTGAGA
CTGATACGGGTATATCGAGACAGAAGAAAAATCATACAGAAGGGGTATTTTCATTCCCTCCACCACTTAGAGATGGACAG
TTGGTGCAGGCAAGCTCTAGTAAATCTTTATGGTCAAACAACTGCAATGCTGTTGTCACTGATGAAACTGATGACTGTAT
GGTGGATTCTGATAACATGCTCGCTTCATGGAGGCAGAAAAGTAATGATTCCTCACCTAGAATGAGTTCTAGGGACGAAA
ATAATGCTAATGCTGTTAGATCCACAAACTCTACTCCCTCAACACTCTCTAATTATGCTTATGCCGAGAGAGAGCATGCC
AAGCAAGAAGAAGAAGATAAAATTGCTGCTGTTAGGGAAGAAGATACAGGAGCATCACTTGAGGATGAAGAGGCAGCTGC
TGTGCAAGAGCAAGTAAGGCAAATAAAGGCTCAAGAGGAAGAGTTTGAGACCTTCAACCTCAAGATTGTGCATAGAAAAA
ACAGAACTGGCTTTGAAGAGGACAAAAATTTTCATGTTGTGTTGAATTCTGTGATAGCTGGGCGCTATCATGTCACCGAA
TATCTTGGATCAGCTGCTTTCAGCAAAGCTATACAAGCACATGATCTGCATACAGGCATGGATGTTTGTGTGAAAATTAT
AAAGAACAACAAAGATTTCTTTGATCAGAGTCTTGATGAGATAAAGCTTCTCAAATATGTCAATAAGCATGATCCTGCTG
ACAAGTACCACATTCTACGTTTGTACGATTACTTCTATTATCGAGAACATCTGTTGATAGTATGTGAACTTCTCAAAGCA
AACTTGTATGAATTTCATAAATTTAATCGGGAGTCTGGAGGGGAGGTCTACTTCACAATGCCAAGACTGCAGTCAATTAC
GACTCAGTGTCTAGAGGCGCTTCAGTTTTTGCATGGCCTTGGCCTGATACATTGTGACTTGAAGCCTGAGAATATACTGG
TGAAAAGCTACAGTAGGTGTGAGGTGAAAGTCATTGATCTTGGGAGTAGTTGCTTTGAGACAGATCATCTCTGCTCCTAT
GTTCAGTCTAGATCATATCGTGCTCCTGAGGTTATCTTGGGACTTCCATATGATAAGAAGATAGATATATGGTCACTTGG
CTGCATCTTGGCTGAACTTTGTACTGGCAATGTGCTCTTCCAGAATGATTCACCTGCAACTTTACTTGCACGGGTGATGG
GAATCATTTGCCCCATTGATCAAAGTATGCTAGCCAAAGGACGTGATACATACAAATACTTCACAAAAAATCACATGCTT
TATGAACGGAATCAGGAAACTAACAGACTGGAATATCTGATACCGAAAAAGACATCCTTGAGGCACCGGCTGCCAATGGG
GGACCAAGGCTTCATTGACTTTGTTGCTCATCTGCTTGAGATAAACCCGAAGAAGCGCCCTTCTGCATCTGAAGCTCTGA
AACACCCGTGGCTATCATATCCTTATGAACCCATATCATCTTGA