Details for Mei Locus Pm025265

Position : Pm7 ( 5`- 16822701 .. 16829384 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm025265

Protein [Map View]
MEEKDEQPSESEAAAAAAAKTSLFPVLPVSQQITSVPHWLSNTSFTTQLSVINDAVISHFKPDPLPSPPPPQEHEEEEVP
SQAKPYEMLESSSGSDRSDERDRTTKKKKHKKRKNKRRRERSVERGRGAFADYGSRKSSVRAWADSETKPSKDYFLDSHG
DPDNLVFGCLYRMDVARYKPFAEVSGSDFQGLYRWNQTGTTLDRDADVDALDGKLKSAGRYWSAKYMALERHTNLKRARI
LVPRDLAVTVSGDFIPLTDGRSSNEGVDGDDSLSRTSVVEESWEDEVIRKTREFNKLTREQPHDEKVWLAFAEFQDRIAD
MQPQKGARLQTLEKKISILEKAAELNPDNEDLLLSLLKAYQSRDSSDVLISRWERILIQHSGSYKLWREFLRVFQGEFSR
FKVSDMRKMYAHAIQALSAACRKHFRQVCQAEDSPPDLATVQLELGLVDIFISFCRFEWQAGYQELATALFQAEIEFSLF
CPSLLLTEQSKQILFEHFWNSDGARVGEEGALGWSTWLEKEEENRQRVIQEETAHDNEGGWTGWSEPLTKNKENSLKTEK
ESESNVLVEEFQEEFEEEDVKKEEDTEALLKMLGIDVDVGTSGEIKDTSTWIKWSEEELSRDCVQWMPVHARAAISHNVG
TPDGEADEHLSRVIMFEDVNEYLFSLSSSEARLSLVLQFIDFFGGKTSQWISTNSSTWAEKVLSFEALPDSMLQTLRRVH
NFLSKTQGSSSNVSLESLLGTSIDIYRRTDLMKFLRNATLLCLSVFPRNFVLEDAALVAEELSVMNSNPSSCSVTPCRAL
AKFLLKSDRQDVLLCGVYARREAFHGNIDHARRVFDMALSSIEGLPLELRSNASLLYFWYAETELGNNNGSGCASSFRAM
HILFCLGSGVTYSPYKSQPSNLQLLRARQGFKERIRTVQMAWVRGVIDDQSVALISSAALFEELTSGWAAGIEVLDQAFS
MVLPERKSRSYQLEFMFNFYMKMLWRHRGQSSLSKCWESILQGLQIFPFSPELLNDLIEVGHLYTTANKLRWVFDDCCQK
KPSVVVWLFALSFEMSKGGSQHRIRGLFERALASDRFHNSVVLWRCYIAYEMKVVCNPSAARRNFFRAIHACPWSKKLWL
DGFLKLNSTLSAKELSDLQEVMRDKELNLRTDIYEILLQDELVL

DNA
ATGGAGGAGAAGGACGAACAACCATCAGAATCAGAAGCAGCAGCAGCGGCAGCAGCAAAAACCTCACTCTTCCCTGTACT
ACCCGTCTCTCAACAAATCACAAGCGTCCCTCACTGGCTTTCCAATACCAGCTTCACCACCCAACTCTCCGTCATAAACG
ACGCCGTTATCTCACACTTCAAACCTGACCCGCTTCCGTCACCACCACCACCGCAAGAACATGAAGAGGAGGAGGTGCCG
TCCCAAGCAAAGCCATACGAGATGCTGGAATCTTCTTCTGGATCCGATAGAAGCGATGAGAGAGACAGGACGACAAAGAA
GAAAAAGCATAAGAAGAGGAAGAACAAGAGGAGGAGAGAGAGGTCCGTTGAGAGAGGCCGTGGAGCATTCGCCGATTACG
GGTCTAGAAAGTCCAGCGTTCGGGCTTGGGCCGACTCCGAGACTAAACCTTCCAAAGATTATTTCCTTGATTCTCATGGC
GACCCCGACAATTTGGTGTTTGGATGTCTCTACAGAATGGACGTTGCTCGCTACAAGCCTTTTGCGGAGGTATCTGGGAG
TGATTTTCAAGGTTTGTATCGGTGGAACCAGACAGGTACAACACTGGATAGAGATGCCGATGTTGATGCATTGGATGGTA
AACTAAAATCTGCTGGTCGCTATTGGTCTGCAAAGTACATGGCTTTGGAACGCCATACGAACTTAAAGCGTGCTCGCATA
CTTGTCCCCAGAGACCTTGCGGTTACAGTTTCCGGTGATTTTATTCCTTTAACGGATGGTCGATCATCCAATGAAGGTGT
TGATGGCGATGATTCACTCTCAAGAACTTCAGTGGTTGAAGAATCTTGGGAAGATGAAGTAATACGCAAAACACGGGAGT
TTAACAAATTGACGAGGGAGCAACCCCATGATGAAAAGGTTTGGTTAGCTTTTGCGGAATTTCAAGACAGGATTGCTGAT
ATGCAACCCCAGAAAGGCGCTCGGTTGCAGACACTGGAAAAAAAGATTAGCATACTGGAGAAGGCGGCTGAGCTTAACCC
AGATAATGAAGACCTGTTGCTTTCTCTTCTAAAGGCTTACCAAAGCAGAGACAGTTCTGATGTGTTAATTAGTAGATGGG
AAAGGATACTCATTCAACATTCAGGAAGTTACAAGTTGTGGAGAGAGTTTTTGCGTGTATTTCAAGGGGAGTTCTCAAGG
TTCAAGGTTTCAGACATGAGAAAAATGTACGCACATGCAATCCAGGCTTTATCTGCTGCATGCAGAAAGCACTTTAGGCA
GGTTTGCCAAGCAGAAGACAGTCCTCCAGATCTTGCTACTGTTCAACTAGAACTTGGTCTGGTTGATATATTTATCAGTT
TCTGTAGGTTTGAATGGCAGGCTGGCTATCAAGAGTTGGCCACTGCTTTATTTCAGGCTGAAATTGAATTCAGTTTGTTT
TGTCCTTCATTACTCCTCACTGAGCAGAGTAAACAGATACTGTTTGAGCACTTTTGGAATAGTGATGGTGCAAGAGTTGG
AGAAGAAGGTGCTCTTGGTTGGTCCACATGGTTGGAAAAAGAGGAAGAAAATAGGCAGAGGGTTATCCAAGAGGAGACTG
CACATGATAATGAAGGTGGCTGGACAGGTTGGTCGGAACCACTAACCAAAAATAAGGAAAATAGTTTAAAGACAGAAAAG
GAATCCGAAAGTAATGTTCTAGTTGAGGAGTTTCAAGAAGAATTTGAGGAAGAAGATGTCAAGAAAGAAGAAGATACTGA
AGCTTTGCTAAAGATGCTAGGAATTGATGTTGATGTTGGTACTAGTGGTGAGATTAAAGACACTTCAACCTGGATCAAAT
GGTCAGAAGAAGAGTTATCGAGAGATTGTGTTCAATGGATGCCTGTTCATGCAAGAGCTGCTATCTCTCATAATGTTGGT
ACACCCGATGGAGAAGCAGATGAGCACCTTTCGAGAGTAATAATGTTTGAAGATGTCAACGAGTACTTATTTTCCTTGAG
CTCATCTGAGGCCCGTTTATCTCTAGTATTGCAATTCATTGATTTCTTTGGTGGGAAAACCTCTCAGTGGATATCTACAA
ACAGTTCAACTTGGGCTGAGAAAGTCCTTAGCTTTGAGGCATTGCCAGATTCTATGTTACAAACTTTGAGAAGGGTTCAT
AATTTTTTAAGCAAAACACAAGGCAGTTCAAGTAATGTCAGCTTGGAATCTCTCTTGGGTACCTCCATTGACATCTACAG
AAGAACAGACCTGATGAAATTTCTTCGTAATGCTACCTTGCTCTGTTTATCTGTTTTTCCACGTAATTTTGTCCTAGAAG
ATGCTGCTTTAGTTGCCGAAGAGCTATCTGTTATGAATTCGAATCCTTCCAGCTGTTCTGTTACCCCGTGTCGAGCTCTC
GCAAAGTTTCTCTTAAAGAGTGACCGTCAGGATGTATTGCTATGTGGAGTTTATGCAAGAAGGGAGGCTTTTCATGGAAA
TATTGATCATGCAAGAAGAGTATTTGACATGGCATTGTCATCTATTGAAGGGCTTCCTTTGGAATTACGGTCTAATGCTT
CCCTTCTATATTTCTGGTATGCTGAGACGGAACTTGGTAACAATAATGGCAGTGGGTGTGCATCATCATTTCGTGCGATG
CATATTTTATTTTGCTTAGGAAGTGGTGTAACATATAGTCCATATAAAAGTCAACCATCAAATTTGCAATTGCTGAGAGC
ACGCCAAGGTTTCAAAGAAAGAATAAGGACAGTACAAATGGCATGGGTGCGAGGTGTTATAGATGATCAATCTGTTGCTC
TCATATCTTCTGCAGCTTTATTCGAAGAGTTAACCTCTGGATGGGCTGCTGGTATTGAAGTTCTAGATCAGGCTTTTTCA
ATGGTGCTCCCGGAGAGAAAGAGCCGTAGTTATCAACTTGAATTTATGTTCAACTTTTACATGAAGATGCTTTGGAGACA
TCGTGGTCAATCAAGTCTATCAAAATGCTGGGAGTCCATATTGCAGGGGCTTCAAATATTTCCGTTCAGCCCAGAACTTT
TAAATGATTTAATCGAGGTTGGCCATCTTTATACAACAGCTAATAAACTGCGATGGGTGTTTGATGACTGCTGTCAGAAG
AAACCGTCTGTGGTTGTCTGGCTTTTTGCGTTGTCATTTGAGATGAGTAAAGGGGGATCACAGCATAGGATCCGTGGATT
GTTTGAAAGGGCATTGGCAAGTGATAGGTTTCATAACTCAGTTGTTCTTTGGCGCTGCTACATTGCATATGAGATGAAGG
TAGTATGCAATCCTTCAGCAGCTAGGCGGAATTTCTTTCGAGCTATTCATGCCTGCCCATGGTCAAAAAAGCTATGGCTT
GATGGGTTTCTCAAATTAAATTCTACCTTGTCTGCAAAAGAGCTGTCAGATCTCCAAGAAGTTATGCGGGATAAGGAGCT
GAATCTGAGAACAGACATATATGAAATTCTTTTGCAAGATGAGCTTGTACTTTAA