Details for Mei Locus Pm025255

Position : Pm7 ( 5`- 16773578 .. 16781222 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm025255

Protein [Map View]
MAGYEREEVPMLSGTHPQLSDENVHLQFERFTSRTRSASVSIPMDSVDLSYEREASLVSHTGPLRSQTKTPFLPMSGPLY
RRRPDNILRPTQAVPGQEESVEPmGEKFPSTNVTNQNEWTDDNYAGKNEHLLRSGQLGMCNDPYCTTCPTYNLKAAQPQH
SRASGIFDPQFHNALYGDAKGWARRFFSFLRPYIPGVMNPHAKVVQQWNKFFVISCLVAIFVDPLFFFLLYVQKDNKCIV
LDWPMTTTLVVFRSMTDFIYLMHILLQIIILLVLRKNLGLSGANYAKNLLRAAVLLQYIPRLCRCLPLLAGQSPSGFIFE
SAWANFIINLLTFVLSGHVVGSCWYLFGLQRVNQCFRDVCHDSGIRGCMSFVDCGHGNEIAGSKVEDPVRDSWKNYTNAN
ACLDKDGFDYGIYSPmVNLTTENSVITRYVYALFWGFQQISTLAGNQTPSYFLWEVLFTMAIIGLGLLLFALLIGNMQNF
LQALGRRRLEMSLRRRDVEQWMRHRRLPEELRRRVRQAERYNWAATRGVNEEILLENLPEDLQTDIRRHLFKFIKKVRIF
SLMDEPILDSICGRLRQKIYIKGSKVLYHGGLIEKMVFIVRGKMESIGEDGITVSLSEGDVCGEELLTWCLEHSSVNRDG
KIRIPGQRLLSNRMVRCLTNVEAFSLRAADIEEVTSLFSRFLRKPRVQGAIRYESPYWRGLAARFIQVAWRYRRKRQSRA
DTSQSQSQSNHIHNHAL

DNA
ATGGCTGGTTATGAAAGAGAAGAGGTACCCATGCTATCGGGCACTCACCCACAATTATCAGATGAAAATGTGCACTTACA
ATTTGAGAGATTTACGTCACGAACCAGAAGTGCATCAGTTTCCATTCCTATGGACTCTGTGGACTTGTCATATGAAAGGG
AGGCTAGCCTTGTAAGCCATACTGGTCCCTTGAGGAGTCAAACAAAAACTCCATTCCTCCCTATGAGTGGTCCATTATAT
AGACGCAGGCCTGATAACATTTTACGGCCAACTCAAGCTGTACCAGGGCAAGAAGAATCAGTCGAACCTGCAGGAGAAAA
GTTTCCTTCTACTAATGTGACAAACCAGAATGAATGGACAGATGACAACTATGCTGGAAAAAATGAACACTTACTGAGAT
CTGGGCAATTAGGGATGTGCAATGATCCTTACTGCACAACTTGCCCAACATACAATCTCAAGGCTGCTCAACCACAACAC
TCAAGGGCTTCCGGTATATTTGATCCCCAGTTCCATAATGCTCTCTATGGGGATGCCAAAGGCTGGGCGAGGAGATTTTT
CTCATTTCTGCGTCCATATATTCCTGGAGTTATGAACCCTCATGCTAAAGTGGTGCAACAGTGGAACAAGTTTTTTGTCA
TTTCATGCTTAGTAGCAATTTTTGTAGATCCATTGTTTTTCTTCTTGCTGTATGTTCAAAAGGATAATAAATGCATAGTT
CTTGATTGGCCCATGACGACAACACTTGTGGTTTTTAGAAGCATGACTGATTTTATATACTTGATGCACATACTCCTTCA
GATCATAATTTTGTTAGTTCTACGAAAAAACTTGGGATTATCTGGTGCAAACTATGCAAAAAATTTGTTACGTGCTGCAG
TTCTTCTTCAGTACATTCCCAGGTTGTGTAGGTGTCTACCCCTGCTTGCTGGTCAGTCTCCAAGTGGCTTCATATTTGAG
TCCGCATGGGCAAACTTCATAATAAATCTTCTCACATTTGTGTTGTCTGGCCATGTTGTTGGGTCGTGCTGGTACCTCTT
CGGGTTACAGAGGGTTAATCAATGTTTTCGAGATGTCTGTCATGACTCTGGAATTCGTGGGTGCATGAGCTTCGTGGATT
GTGGGCATGGAAATGAGATTGCAGGTTCTAAAGTGGAAGATCCAGTACGTGATAGCTGGAAAAACTATACGAATGCTAAT
GCTTGTTTAGATAAAGATGGTTTTGATTACGGAATCTACAGCCCAGCTGTCAATCTTACAACAGAAAATAGTGTAATCAC
GAGATATGTATACGCCCTGTTTTGGGGATTCCAGCAAATCAGTACTCTGGCTGGAAATCAAACTCCAAGTTATTTTCTTT
GGGAAGTCCTTTTTACAATGGCTATTATTGGCCTAGGGCTCTTGCTTTTTGCTCTTCTCATTGGAAATATGCAGAACTTT
CTGCAGGCTCTTGGTCGGAGAAGGTTAGAAATGTCTCTGAGACGTCGTGACGTTGAGCAGTGGATGAGACATAGACGGTT
GCCAGAGGAACTTAGAAGGCGAGTACGACAAGCTGAAAGGTACAATTGGGCCGCAACCAGAGGGGTAAATGAAGAAATCC
TTTTGGAAAACTTGCCTGAAGACCTTCAGACAGATATAAGACGCCATCTCTTCAAGTTTATTAAGAAAGTACGAATTTTT
TCCCTGATGGATGAACCCATCTTGGATTCCATTTGTGGAAGACTAAGACAAAAGATATACATCAAAGGAAGCAAAGTTTT
GTACCATGGTGGTCTAATTGAGAAAATGGTTTTTATTGTGCGGGGAAAAATGGAGAGCATTGGAGAAGATGGGATTACAG
TTTCCTTATCTGAAGGGGATGTTTGTGGTGAGGAACTTCTCACATGGTGCCTTGAGCATTCTTCAGTGAACAGAGACGGT
AAGATCAGGATTCCTGGACAGCGATTGCTTAGCAACAGGATGGTGAGATGCTTAACAAACGTGGAAGCATTTTCACTCCG
AGCTGCAGACATTGAAGAAGTCACCAGTCTTTTCTCCAGATTTTTGCGAAAACCACGTGTTCAAGGAGCCATAAGATATG
AATCACCTTACTGGAGAGGGCTTGCAGCAAGATTCATTCAAGTAGCCTGGAGATACAGGAGAAAACGCCAAAGTCGAGCA
GACACCTCACAATCCCAGTCCCAATCCAATCATATTCATAACCATGCATTATAA