Details for Mei Locus Pm025240

Position : Pm7 ( 5`- 16690994 .. 16692959 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm025240

Protein [Map View]
MKTLEKPIIMSASIHSAPTPTPTPTPRRRSLSSSSSSNNSCTTTSTNPSTMKPKWLLSILADVEEKMKMLGCSRATAQQE
IGDTFAERAEAYYKRRPQLLSLIRDLYNSYLTLSDRYIQTLAKTQHHRPPSSQISVIDNDYYDYDDQEEDDDAYTSHIDS
DVESSLSYQQLPPTLLLAASVATQHDDTMFDLDSIVTDIVVKNVEYDILLDEANITERRYKDASRKIELQKSLLEVLESE
RLILLNENAKLGYKVGALVEENKALASESLFIRRKAGELARCLLKTREDQRVCMLSRKIEDLQGQIYGLEKRNKDYYEQL
VKRDQRSFQLVQEEEESCNINKSKINGNQVNLEVCFQIRKINRRLIKRGGNSNGSGKEIGVGKEKKGSSSSLWERVKNMD
LFLCGRNQNST

DNA
ATGAAGACACTGGAGAAACCAATAATAATGTCGGCTTCCATTCACTCAGCTCCAACTCCAACTCCAACTCCAACTCCAAG
ACGGAGGAGCTTAAGCAGTAGCAGCAGCAGCAATAACAGTTGCACCACCACCTCCACCAACCCCTCCACCATGAAACCCA
AATGGCTTTTGTCCATCCTTGCTGATGTGGAAGAGAAGATGAAGATGTTGGGATGTAGCAGAGCCACAGCTCAACAAGAG
ATTGGGGACACCTTCGCTGAACGTGCTGAAGCTTACTACAAAAGACGTCCTCAGCTGCTCTCCCTGATTCGAGACTTGTA
CAATTCCTACCTCACCTTATCTGACCGTTACATTCAAACTCTCGCCAAGACTCAGCATCACCGTCCACCCTCTTCCCAAA
TCTCAGTAATAGATAATGACTATTATGACTATGACGACCAAGAAGAAGATGATGATGCTTACACAAGCCACATTGATTCG
GACGTAGAGAGTTCCCTCTCCTATCAGCAATTGCCTCCAACATTACTACTCGCTGCTTCTGTTGCTACTCAACATGATGA
CACCATGTTTGATTTAGATTCCATCGTTACGGACATTGTGGTGAAGAATGTTGAATATGATATCTTACTTGATGAGGCCA
ACATCACGGAGAGGCGATACAAGGATGCATCCAGGAAGATAGAGCTGCAGAAGAGCTTGCTAGAGGTGTTGGAGTCTGAG
AGGCTCATCTTACTCAATGAGAATGCCAAGTTGGGGTATAAAGTGGGTGCCTTGGTGGAAGAGAACAAAGCCCTTGCGTC
CGAGTCTCTCTTCATCAGGAGGAAGGCTGGCGAGCTAGCTCGGTGTTTGCTCAAGACGAGGGAAGACCAGAGGGTGTGCA
TGCTTAGCCGTAAAATCGAGGACCTTCAGGGACAGATTTATGGCTTGGAGAAGAGGAACAAGGACTACTATGAGCAACTT
GTGAAGAGAGACCAAAGATCCTTTCAACTTGTACAAGAAGAAGAAGAGAGTTGCAACATCAACAAGAGCAAGATAAATGG
TAATCAGGTGAATTTGGAGGTTTGCTTTCAGATACGGAAGATTAATCGGAGGCTGATCAAGAGAGGAGGTAATAGTAATG
GTAGTGGGAAGGAGATTGGCGTCGGAAAGGAGAAGAAGGGTTCTTCTTCTAGTTTGTGGGAAAGGGTCAAGAACATGGAT
TTGTTTCTATGTGGACGTAATCAAAACTCTACGTAA