Details for Mei Locus Pm019076

Position : Pm5 ( 5`- 21989132 .. 21991115 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm019076

Protein [Map View]
MDETTISLILQACELARDLESNLHNLANQPNLLSNSLDEITKKFVTARERVYGQDPSTSSSLHNMLTLVHQQQIGTSHVQ
EWLRSSYATQLVADQKEAKIGGCIDDDDAEVKGLQAMDIVSASDTNIASSSSQRARRRKDQGLISKITVPAPRIGNTEIP
PEDGFTWRKYGQKEIMGSRFPRSYYRCTHQKLYNCPmKKQVQRLNNDPLTFEVMYRGEHTCHMSATAPSIPPPSAEHHNA
TQESMAQTLATTTTADPPTASLWLSMDFNPIRGGGGSSSRIIGGDHGGGDGVGTSTTTRYGKEVDFPVVDLADAMFNSGS
SSSNSMDFIFHSAENKWESEDKKN

DNA
ATGGATGAAACCACCATTTCTTTGATCCTTCAGGCTTGTGAGTTAGCCAGAGACCTCGAATCAAACCTACACAACTTGGC
CAACCAGCCCAACTTGCTCTCAAACTCCTTGGATGAGATCACAAAGAAATTTGTTACAGCCAGAGAGAGAGTGTATGGTC
AAGATCCAAGTACTTCTTCAAGTCTGCACAACATGCTTACTCTTGTGCACCAGCAGCAGATTGGTACAAGTCATGTACAA
GAATGGCTGAGGTCTAGTTATGCAACCCAACTTGTAGCTGATCAGAAGGAAGCTAAGATTGGAGGCTGCATCGATGACGA
TGATGCAGAGGTTAAGGGCCTTCAGGCAATGGATATAGTATCAGCTTCTGACACGAACATTGCTTCATCATCCTCACAAA
GAGCAAGAAGAAGGAAGGATCAGGGGTTAATCAGCAAAATTACAGTTCCAGCACCTCGGATTGGAAATACAGAAATCCCA
CCAGAGGATGGCTTCACTTGGAGAAAATATGGTCAGAAGGAGATCATGGGCTCCAGGTTCCCAAGGAGTTACTATAGGTG
CACCCACCAAAAGCTCTACAATTGCCCAGCCAAGAAGCAAGTCCAGAGGCTTAACAATGATCCCTTAACATTTGAAGTAA
TGTACAGGGGTGAACATACATGTCACATGTCAGCCACTGCACCTTCAATTCCACCACCATCAGCAGAACATCATAATGCT
ACACAAGAGAGTATGGCCCAAACCCTAGCGACTACCACAACCGCTGACCCTCCTACAGCATCTCTATGGCTTTCCATGGA
CTTTAACCCAATTAGAGGAGGCGGCGGCAGCAGCAGCAGGATAATAGGTGGCGACCATGGCGGTGGTGATGGTGTAGGCA
CATCCACCACCACGCGTTACGGTAAAGAAGTTGACTTTCCTGTAGTGGATTTGGCTGATGCAATGTTCAATTCAGGCAGC
AGCAGCAGCAATAGTATGGATTTTATTTTCCATTCTGCTGAAAACAAATGGGAGTCAGAGGACAAGAAAAACTGA