Details for Mei Locus Pm019064

Position : Pm5 ( 5`- 21939810 .. 21942255 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm019064

Protein [Map View]
MQAIGGLNNLRAVNLGKNRFTGQVPDGIGSCLLLRSIDLSENSFSGNLPQTMQKLSLCSYLNLHQNSFAGEIPEWIGELK
SLETLDLSGNRFLGEVPSSIGNLQALKVLNFSANGFTGNLPKSMAYCTSLVALDFSKNSVAGELPmWIFKAGLEEVSLSE
KKLSGSANSPVSSSIGNAPQNLQVVDLSLINFLVKLHLTLGLLSLNLSGNSLVGPIPVTIGELKALDNVDLSENRLSGSI
PLEIGGAFSLKELRLENNLLTGKIPTSIGNCSSLTTLITSQNRLTGPVPmGMAKLTNLQNVDLSFNNLTGGLPKQLANLP
NLLSFNISHNNLQGELPmGAFFNTISPSSVSGNPSLCGSAVNKSCPTVLPKPIVLNPNSSSDSTTPGTLSSNLGHRRIIL
SISALVAIAAAAVIVIGVIAITVLNLHVRSSTTHSPmALALSAGDDFSHSPTTDGNSGKLVMFSGEPDFSTGAHALLNKD
CELGRGGFGAVYRTVLRDGRPVAIKKLTVSSLVKSQEEF

DNA
ATGCAAGCCATTGGAGGACTGAATAACTTGCGAGCAGTTAATTTGGGGAAGAATCGGTTTACTGGGCAAGTTCCAGATGG
AATTGGAAGTTGCTTGCTTTTGAGGTCCATTGATCTCAGCGAGAATTCATTCTCTGGGAACCTTCCTCAGACAATGCAGA
AACTTAGCCTGTGTAGCTATCTAAATCTGCACCAAAACTCATTTGCCGGAGAGATTCCTGAGTGGATTGGAGAGTTGAAG
AGCCTGGAGACTTTGGACCTTTCTGGCAATCGATTTTTGGGCGAAGTTCCAAGTTCAATAGGTAATCTTCAGGCTTTAAA
GGTGTTGAATTTTTCTGCAAATGGGTTCACTGGGAACTTACCCAAGTCCATGGCTTATTGCACAAGCCTTGTGGCTTTAG
ATTTTAGTAAGAATTCGGTGGCGGGTGAACTTCCTGCGTGGATATTCAAGGCGGGTTTAGAGGAAGTTTCACTTTCAGAG
AAAAAACTAAGTGGAAGCGCAAATAGCCCTGTATCTTCCTCAATTGGAAATGCGCCTCAAAATCTGCAAGTCGTGGATTT
ATCCTTAATCAATTTTCTGGTGAAATTGCATCTGACATTGGGTTTACTTAGTTTGAACCTCTCCGGTAACTCTCTTGTTG
GTCCTATTCCTGTGACTATTGGAGAGTTGAAGGCCCTGGACAATGTGGATTTGAGTGAGAATCGGCTCAGTGGAAGCATC
CCTCTGGAAATTGGTGGGGCTTTTTCATTGAAGGAATTGAGATTGGAAAATAACCTTCTCACGGGAAAAATTCCAACTTC
AATAGGGAACTGTTCTTCTCTGACCACTTTAATTACATCACAGAACAGACTGACTGGCCCAGTACCTGCAGGAATGGCCA
AACTTACCAACTTACAAAATGTGGACTTGTCTTTCAATAACCTCACGGGAGGCCTACCCAAGCAGTTAGCCAATCTTCCC
AACCTTCTTTCCTTCAATATTTCCCACAACAACCTCCAGGGTGAACTACCTGCGGGCGCCTTTTTCAATACCATCTCCCC
TTCCTCTGTCTCTGGCAATCCATCTCTTTGTGGCTCTGCAGTTAATAAGTCTTGCCCAACAGTTCTTCCGAAACCCATTG
TCCTCAATCCCAACTCCTCTTCTGACTCCACCACACCAGGAACATTATCTTCAAATCTTGGTCATAGAAGAATCATCCTT
AGTATTTCTGCACTCGTTGCCATTGCTGCAGCTGCTGTCATTGTCATTGGTGTGATTGCCATCACTGTACTTAATCTCCA
TGTTCGATCTTCTACAACTCATTCACCAGCAGCCCTCGCGTTATCAGCTGGGGATGATTTCAGCCATTCCCCAACAACAG
ATGGCAACTCCGGCAAGCTTGTCATGTTTTCAGGTGAGCCTGACTTCAGCACTGGTGCACATGCTCTACTCAACAAGGAC
TGTGAGCTTGGTCGTGGAGGGTTTGGAGCAGTCTATAGGACAGTTCTTCGAGATGGGCGGCCTGTTGCAATCAAGAAGCT
CACTGTTTCAAGTCTTGTCAAGTCTCAAGAAGAATTTTAA