Details for Mei Locus Pm015928

Position : Pm4 ( 5`- 22135377 .. 22137115 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm015928

Protein [Map View]
MPLKWMGDESILTFWMLSIVATPmIEQKKQKISEIKAGIDDAESLIRKMDLEARSLPPNIKAVLLAKLREYKSDLNNLKS
EVKRLVSGNSYSSARDELLESGMADTLTASADQRGRLMMSTERLNKSSDRVKDSRRTMLETEELGVSILQDLHSQRQSLL
HANNTLHGVDDNIGKSKKVLTSMARRMSRNKWIIGSVIAVLVIAIALILYFKLK

DNA
ATGCCATTGAAATGGATGGGAGACGAATCCATTCTGACTTTTTGGATGTTGAGTATTGTAGCAACACCAGCCATAGAGCA
AAAGAAGCAAAAGATTTCTGAAATAAAGGCTGGAATTGATGATGCAGAATCTTTGATCCGGAAAATGGACCTCGAGGCAA
GAAGTTTGCCACCAAATATTAAAGCTGTGCTTCTTGCTAAGTTGAGGGAATATAAATCAGATCTGAATAATCTGAAAAGC
GAAGTTAAAAGACTTGTATCTGGTAACTCATATTCATCTGCCCGAGATGAGTTGTTGGAATCAGGCATGGCTGATACTCT
GACGGCATCAGCTGATCAAAGAGGAAGGCTAATGATGTCAACAGAGAGATTAAACAAGTCTAGTGATAGAGTTAAGGACA
GTAGAAGAACCATGCTGGAAACAGAAGAGCTTGGTGTTTCAATCCTTCAAGATCTGCATTCACAGAGACAGTCTCTGTTA
CATGCAAATAACACGCTTCATGGGGTGGATGACAACATAGGGAAAAGCAAGAAAGTTTTGACTTCCATGGCACGGAGGAT
GAGCAGGAACAAGTGGATTATTGGCAGTGTTATTGCCGTTCTTGTCATTGCCATCGCCTTGATCTTGTACTTCAAACTTA
AATAG