Details for Mei Locus Pm015921

Position : Pm4 ( 5`- 22117365 .. 22119089 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm015921

Protein [Map View]
MAHSMRFDLQSGATKCISDDIKSNAMTVGKYSVVNHNEGFPKPDSHKVTVRVTSPYGSNYHYGDHVESGNFAFTAAETGD
YSACFWVSDRKPSTTVTIDFDWKTGVAAKEWSKVAKKGQIETMEVELTKLYDTVSSIHDEMFFLREREEEMQQLNRSTNS
KMATFSFLSLLVCLSVAGLQLWHLKMFFERKKLL

DNA
ATGGCGCATTCAATGCGTTTCGACCTTCAATCGGGCGCCACCAAGTGCATCTCAGACGACATAAAGAGCAATGCCATGAC
GGTGGGCAAGTATTCCGTCGTTAACCACAACGAGGGCTTTCCTAAACCTGATTCTCATAAGGTCACTGTCAGGGTGACCT
CACCTTATGGAAGTAATTATCACTATGGGGATCACGTGGAATCGGGTAATTTTGCGTTTACTGCGGCAGAGACTGGTGAT
TATTCAGCTTGCTTTTGGGTGTCTGATCGTAAGCCCTCGACCACGGTGACCATTGATTTTGACTGGAAAACTGGAGTGGC
TGCTAAGGAATGGTCCAAGGTTGCCAAGAAAGGGCAGATTGAAACGATGGAAGTTGAGCTGACAAAATTATATGATACTG
TCTCATCCATTCATGATGAGATGTTTTTTCTTCGTGAAAGGGAGGAAGAAATGCAACAACTTAACAGATCAACTAACTCC
AAGATGGCGACTTTTAGCTTCCTTTCCCTTCTGGTTTGCCTGTCAGTGGCCGGTTTGCAACTATGGCACCTCAAGATGTT
CTTTGAGAGGAAGAAGCTCCTCTAG