Details for Mei Locus Pm006463

Position : Pm2 ( 5`- 16972262 .. 16973755 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006463

Protein [Map View]
MDAASLAAASATTMKAVNFFSTPITQRIATHPTTLTSPIPHTKPNVHALCLPNSNPRSRAISLITRCSIKPDTDTTDNEK
EQNSTVEPNLNSEPTNPSTPFSNDALSSPISTSFSSSNTKGLVLGLGFENSWDSAEVGSPVVKRFLGDEEERWYMWYYGK
SSSNPNPGSDSIGLAVSSNGVHWERGVGQVQSSQDVGAVINCGKDWWAFDTQSIRPSEVVVMSSSKVRASSAVYWLYYTG
YSAEEAENISNHSQEINLENPERFLLDGLISDKNGGIGKIFKSLPGLAISQDGRHWARIEGEHHSGALFDVGLQGEWDSS
FIAAPHVVFHESGDLRMYYHSFDLEMGNYSIGMARSRDGIKWVKLGKIIGGGRSGYFDELGAMNPCVVRNRKDGEYLMAY
EGVGGDGGRSIGLAVSPDGLKDWTRLKDDEVVLKASEDCGWDNKGVGSPCLVQMDGEEDEWRLYYRGVGIEGRTGIGMAV
SEGSDVTRFRRCAGFHL

DNA
ATGGATGCAGCATCACTAGCAGCAGCTTCTGCTACAACAATGAAAGCCGTTAACTTTTTTTCAACTCCAATTACCCAAAG
AATAGCTACCCACCCGACTACATTAACCTCTCCAATTCCTCACACTAAACCAAACGTACACGCTCTCTGTCTCCCAAACT
CTAACCCTAGAAGCAGAGCCATTTCTCTGATAACTCGATGCTCCATAAAGCCAGACACGGACACGACTGACAACGAGAAA
GAACAGAATTCGACCGTTGAACCCAATTTAAATTCAGAACCGACAAACCCATCAACGCCCTTTTCAAATGATGCACTCTC
TTCTCCTATATCAACCTCATTTTCTTCTTCTAATACCAAAGGATTGGTGTTGGGTTTGGGCTTTGAAAATTCATGGGACA
GTGCAGAAGTTGGGTCACCAGTTGTGAAGAGGTTCCTGGGTGACGAGGAAGAGAGATGGTACATGTGGTACTATGGGAAG
TCCAGTTCAAATCCAAACCCAGGTTCGGATTCGATTGGATTAGCAGTTTCAAGCAATGGGGTTCATTGGGAACGAGGAGT
TGGACAAGTTCAATCGAGCCAGGATGTGGGTGCGGTGATCAATTGCGGCAAAGATTGGTGGGCATTTGATACTCAGAGCA
TTAGGCCTTCTGAGGTAGTGGTCATGTCCAGTTCAAAGGTCAGAGCTTCCAGTGCTGTTTATTGGCTCTATTACACTGGC
TACAGTGCTGAGGAGGCAGAGAATATTTCTAATCATTCTCAAGAAATCAATTTGGAGAACCCAGAAAGGTTCCTTCTTGA
TGGTTTGATCAGTGATAAAAATGGTGGGATTGGGAAGATTTTCAAGTCTTTGCCTGGTTTGGCAATTAGTCAAGACGGGA
GGCATTGGGCTAGAATTGAAGGGGAGCATCACAGTGGGGCTCTGTTTGATGTGGGGTTGCAAGGAGAGTGGGATTCTTCA
TTCATTGCTGCACCTCATGTTGTTTTCCATGAAAGTGGTGATCTTAGAATGTATTACCATTCATTTGATTTGGAGATGGG
AAATTACTCAATTGGGATGGCAAGATCAAGGGATGGGATTAAGTGGGTGAAATTGGGGAAAATAATAGGGGGAGGAAGAA
GTGGTTACTTTGATGAGTTGGGAGCAATGAATCCATGTGTAGTGAGGAACAGGAAAGATGGGGAGTATTTGATGGCATAT
GAAGGTGTTGGTGGTGATGGTGGGAGGAGCATCGGTTTGGCTGTGTCCCCAGATGGGTTGAAGGATTGGACAAGGTTGAA
GGATGATGAGGTGGTTTTGAAGGCCTCTGAGGATTGTGGATGGGATAACAAAGGGGTTGGATCTCCGTGTTTGGTTCAGA
TGGATGGGGAGGAAGATGAGTGGAGGTTGTATTATAGAGGTGTTGGGATTGAGGGAAGGACTGGGATTGGAATGGCAGTT
TCAGAAGGGAGTGATGTTACAAGGTTTAGGAGATGCGCAGGATTTCATTTGTAA